DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Samuel

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001260372.1 Gene:Samuel FlyBaseID:FBgn0032330 Length:968 Species:Drosophila melanogaster

Alignment Length:585 Identity:119/586 (20%)
Similarity:197/586 (34%) Gaps:165/586 (28%)


  Fly    31 SPSTANCNGVASASGGNPNPNSLLTLAPRKEELRFLP-LAPMGGNKTCNITISNVQPMKSKLKSV 94
            :||:::..|....:||..:|:.......:::.|:... |:|..|......|.:      |.|.|.
  Fly   275 TPSSSSYRGAGGGAGGGVSPSHQQQQQQQQQSLQQQQRLSPPSGPSMATATTT------SSLSSS 333

  Fly    95 NIVPNSIKSAGAGAT--------------VGSADAPLFQLVPSPSNPSQPLVAILAPNRKTTLLG 145
            :....|..::.:.||              :..|.|...||..|.||.|.   .|...:..|...|
  Fly   334 SSASASASASASAATHMPLHNLSTNLLNSIQQAAASQQQLRSSNSNSSS---NISGSSNNTKSDG 395

  Fly   146 GGASNGQPVVIRSGTPL-------------HKNSLTVETSNKPIQPGGSAAAAAVGGGTGGAPLT 197
            |.|||......|:.:.:             :.|:.|...|........:.|....|||.|||.  
  Fly   396 GAASNATDFSTRNYSDIMRCLAAKYNNANPNDNNATRRNSYYDGSTSATTATGGAGGGGGGAG-- 458

  Fly   198 LVGKTVVPPKIQAATPVQIPSTGPGAQVSLLANPLKPRAPLILSKVAVDKLRLKFSQVKSNPNAL 262
              |....|   .:|......|||   ..:..|..|.|.|....:..||.                
  Fly   459 --GSNSAP---SSALKTASSSTG---STTTTAKKLSPSAASAANSAAVS---------------- 499

  Fly   263 VLGKANHVKKLLTSPNPSGEDKTRSTQKNNKQNTSASQLKPVVAPKTAMPIATEVPTADNNKMSL 327
             |.|.:.|..:      .|.....:...:....:|.|||.|   |.|| |..||           
  Fly   500 -LSKESKVSAV------GGAGVGGAVASSGGGGSSMSQLAP---PPTA-PSPTE----------- 542

  Fly   328 IKSKPVAIKAVPLPSQEAPIVPA--VAPVVTS---------PEKVDVKPTAKPSIKTAPKPTPKP 381
             ::|          ||.|.:|.|  |:|.:|:         |..:|:..|  .::.|..:..   
  Fly   543 -QAK----------SQMAAVVAAASVSPFMTNFLPFSSGIFPPLIDMSST--QALLTLARAV--- 591

  Fly   382 LEMSVNGPAKEKKAPAKEQKQKTMDKPPVVKEIAQHTPCGPKELPKLKRSKSFVSNHPASPVANN 446
                                     |...::||.:         .|.:||.|..|: |::..|..
  Fly   592 -------------------------KDAEIQEILR---------SKQQRSGSNASS-PSASAAGT 621

  Fly   447 ERRHSVAIMAKEVDVIEQPSAAIETITIEDDDESEEEQQKPEIKKTPKQNQKPEKQEAPKKKQIP 511
            .|..|....|..........|.|.:..::   :.:::||:...::..:|:|...:|.:|:.....
  Fly   622 PRSSSTLNAALHQAAQFVTPALIYSAQLQ---QQQQQQQQQHQRQQQQQSQHASRQSSPRSTNDS 683

  Fly   512 MPILPAG-------------ITISTTSTAKK--KAVRKNSSVTTISSSSSDSSSYSDVEVVPTKK 561
            ..:.|.|             :.:|:...|.|  ||.|:.||..|.:::::..||.|.....|.::
  Fly   684 TTVAPIGDGGGGSSIASAAPLDLSSQPPAAKRFKAERRASSTATTATTATTGSSTSTPSPPPLEQ 748

  Fly   562  561
              Fly   749  748

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
SamuelNP_001260372.1 SAM_Samd7,11 795..862 CDD:188978
SAM 795..852 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12247
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.