DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and L3mbtl4

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_796252.2 Gene:L3mbtl4 MGIID:2444889 Length:621 Species:Mus musculus

Alignment Length:633 Identity:210/634 (33%)
Similarity:306/634 (48%) Gaps:87/634 (14%)


  Fly   790 RQTNYKPHKSLSAIQEQLQQR---QKDKPRKP------------------FRWSEYLKSKGKDVA 833
            ||.|.|...||.:.:...|.|   |.::.:||                  :.|.:||: :|..||
Mouse     2 RQPNRKRKLSLESTERMNQDRCTGQTEEEKKPGEVTTPSKRESSVTTAETWSWEQYLR-EGNAVA 65

  Fly   834 APIHLFL--NPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVN 896
            ||:.||.  ..||...|.|::||:||.||....|:|||.|:.||.||||:|.||||.|.||||.|
Mouse    66 APVELFSKDQSFPEHENGFQVGMRLEGIDARRPSVFCVLSVAEVCGYRLRLHFDGYLSCYDFWTN 130

  Fly   897 ADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFA 961
            |.|.||.|.|||.:|...|..|:||..::|.|..||.....:.||:.||  .|......|...|.
Mouse   131 AGSPDIHPVGWCQKTKHELHIPRDYRKDKFVWMDYLKACRLQNAPKKLF--RNRSSNGPVPREFQ 193

  Fly   962 VGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGW-HEGRQQLI 1025
            |||.|||.|..:...:||||:.||:::|:|||||..||.:|.|..:.||||.|.|| .|..:.|:
Mouse   194 VGMKLEAVDRRNPCLMCVATIADIVEDRVRVHFDSLDDSFDYWCDVNSPYIQPVGWCQENGRTLV 258

  Fly  1026 VPPDY-QKSAFIWDDYISEVGGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPATVVTRKG 1089
            .|..| ....|.|.||:......|...:.|..|.|..:...||||.||:|||.|||.||:.....
Mouse   259 APQGYPHPDKFSWTDYLRASQSKAVPAKAFGMRTPHGFLPNMKLEAVDKRNPQLIRVATIADVDD 323

  Fly  1090 YRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGYLQPKSVMP----CDVEGCRGF 1150
            |||::|.|.|..:|.:|::.||.|:||||||:.|.|.||.|.|....| ::|    |...||||.
Mouse   324 YRVKIHFDGWDHKYDYWVDADSQDIHPIGWCDVTGHPLEVPYGSKHVK-ILPGQPACPTPGCRGI 387

  Fly  1151 GNAKRFNLNVHALRECCPYAPENWR-------QWRSKTVKPPRVAPENIR---------RGWAKK 1199
            |:.:......|.....|||:..|.:       :.|.:|.....:.|.:.:         .|..:.
Mouse   388 GHIRGPRYAGHHSAFGCPYSDVNLKREAALQDRLREQTQANLELDPSHSKSENPCNLNVNGKCEN 452

  Fly  1200 TKRACSEAKQAI------KEDSQQE------IVYPKVAEVVQAKRKTSPCEEKVVKKQKQMQKEE 1252
            ....|...:||.      |||...:      :.:|:..|...|:          |::........
Mouse   453 ANSQCRLVQQAKCLKIKGKEDIDLDNLFRVLVFHPRRLEYSAAQ----------VQQMLHQPLSM 507

  Fly  1253 DAEQVPDERSLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPL-HWTSWDVCEYIERALD 1316
            .:......|.:.::|    :...:.||.           :.|::.:.: .||..:|.|:::..|.
Mouse   508 TSTSAHPFRDIPLSR----EQHCKLLPG-----------VADIQASQVARWTVDEVAEFVQSLLG 557

  Fly  1317 STDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLR 1364
            ..:.||...::.|||:|.|:|.:.::...:::|:|||:|:|:.||..|
Mouse   558 CEEHAKCFKKEQIDGKAFLLLTQADIVKVMRIKLGPALKIYNSILMFR 605

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 51/98 (52%)
MBT 929..1028 CDD:214723 42/100 (42%)
MBT 1038..1130 CDD:214723 41/92 (45%)
SAM_PNT 1279..1366 CDD:280377 24/88 (27%)
L3mbtl4NP_796252.2 MBT 1 52..152 52/101 (51%)
MBT 55..149 CDD:214723 50/95 (53%)
MBT 2 160..260 43/102 (42%)
MBT 164..260 CDD:214723 41/98 (42%)
MBT 3 269..364 43/95 (45%)
MBT 273..364 CDD:214723 41/91 (45%)
zf-C2HC 379..405 CDD:279824 8/26 (31%)
SAM 540..607 CDD:197735 22/67 (33%)
SAM_Scm-like-3MBT3,4 540..605 CDD:188981 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86196421
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002641
OrthoInspector 1 1.000 T616443
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5341
TreeFam 1 0.960
76.920

Return to query results.
Submit another query.