DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Phc2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001013187.2 Gene:Phc2 RGDID:1307912 Length:850 Species:Rattus norvegicus

Alignment Length:752 Identity:161/753 (21%)
Similarity:261/753 (35%) Gaps:250/753 (33%)


  Fly     5 SMASAEAKQLQRNISLSMSPANGGVI----SPSTANCNGVASAS---GGNPNPNSLLTLAP---R 59
            |..|::|.....:::|:.|||...:|    |.::|..:|:|..:   |...:|....:.|.   |
  Rat   125 SSVSSQAPAQSSSLNLAASPAAAQLINRAQSVNSATASGLAQQAVLLGNTSSPALTASQAQMYLR 189

  Fly    60 KEELRFLPLAPMGGNKTCNITISNVQ-----------PMKSKLKSVNIVPNSIKSAGAGATVGSA 113
            .:.|.|.|.|          |::.||           |..::::::.:......:|.|.|.... 
  Rat   190 AQMLIFTPTA----------TVATVQPELGTGSPARPPTPAQVQNLTLRTQQTPAAAAAAAASG- 243

  Fly   114 DAPLFQLVPSPSNPSQPLVAILAPNRKTTLLGGGASNGQPV-------VIRSGTPLHKNSLTVET 171
                    |:|:.|..|.:|:     |.|     .|:.||:       .:..|:|:.......:.
  Rat   244 --------PAPTQPVLPSLAL-----KPT-----PSSSQPLPPTPQGRTVVQGSPVGAKPSVTDN 290

  Fly   172 SNKPIQPGGSAAAAAVGGGTGGAPLTLVGKTVVPPKIQAATPVQI---PST-GPGAQVSLLANPL 232
            ..:|::..|::...|..|.......|:....:..|......|.|:   ||: .|..|......|.
  Rat   291 VTEPLKTDGNSNMEARPGPDRATVPTVATHQLTAPAYTQLQPHQLLPQPSSKHPQPQFVAQQQPQ 355

  Fly   233 KPR-APLILSKVAVDKLRLKFS-QVKSNPNALVLGKAN----------HVKKLLTS-----PNP- 279
            .|| .|.:.|:..:..:....: |.....:|:.||...          ||.|..:|     |.| 
  Rat   356 PPRPTPQVQSQPQLAAVSPSLALQPSPEGHAMPLGPVTQALPLQCSTAHVHKPGSSQQCHLPTPD 420

  Fly   280 SG------EDKTRSTQKNNKQNTSA--SQLKPV------VAP---KTAMPIATEVPTADNNKMSL 327
            ||      |..:.:.|: ..|:|||  .||:|.      .||   |..:|....||.   .:..|
  Rat   421 SGSQNGHPEGVSHAPQR-RFQHTSAVILQLQPASPVPQQCAPDDWKEVVPAEKSVPV---TRPGL 481

  Fly   328 IKSKPVAIKAVP--LPSQEAP-------------IVPAV----APVVTS-------------PEK 360
            ...:...|.|:|  ||..::|             ||.|:    :|.:||             |:.
  Rat   482 SPHQQAIITAIPGGLPGPKSPNIQQCPAHETGQGIVHALTDLSSPGMTSGNGNSASSITGTAPQN 546

  Fly   361 VDVKP---TAKPSIKT----------APKPTPKPLEMSVNGPAKEK--------KAPAKEQKQKT 404
            .:.||   ..||.|.|          ..:|.|......:.|..|:|        |.|.::....|
  Rat   547 GENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKLPQQDHTTTT 611

  Fly   405 ---MDKPPVVKEIAQHTP-------CGPKELP-KLKRSKSFVSNHPASPVANNERRHSVAIMAKE 458
               |::|.:.:...:.||       ||..:.. |.||||.|.|...|       :|::|. ..|.
  Rat   612 DSEMEEPYLQESKEEGTPLKLKCELCGRVDFAYKFKRSKRFCSMACA-------KRYNVG-CTKR 668

  Fly   459 VDVIEQPSAAIETITIEDDDESEEEQQKPEIKKTPKQNQKPEKQEAPKKKQIPMPILPAGITIST 523
            |.:..             .|.|:.::                                ||.|...
  Rat   669 VGLFH-------------SDRSKLQK--------------------------------AGTTTHN 688

  Fly   524 TSTAKKKAVRKNSSVTTISSSSSDSSSYSDVEVVPTKKTEKELSMLPGISIIKAESLPLSREDFE 588
            ...|.|      :|:.|:                 ||.|:|:.|....:|:..|..|..|:||  
  Rat   689 RRRASK------ASLPTL-----------------TKDTKKQPSGTVPLSVTAALQLAHSQED-- 728

  Fly   589 RSLRCDE----QVPQTPPKSSSSSS---SGSHASEMS 618
             |.||.:    :.|.:|..:|||:|   .|....|:|
  Rat   729 -SSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLELS 764

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
Phc2NP_001013187.2 PHC2_SAM_assoc 662..780 CDD:293222 35/176 (20%)
SAM_Ph1,2,3 781..849 CDD:188976
SAM 783..850 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87319484
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.