DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and CG2662

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001284832.1 Gene:CG2662 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster

Alignment Length:423 Identity:84/424 (20%)
Similarity:152/424 (36%) Gaps:131/424 (31%)


  Fly  1038 DDYIS-------EVGGMAASKELFTP------------------RQPMEYQERMKLEVVDQRNPC 1077
            |:|:|       .:..:.|:..:.:|                  :|..:.|:..:|...|....|
  Fly    74 DNYVSRASSNRNSLSSVPATSNVQSPPVKEATDSQDSTTSPVSEQQQQQLQQAAQLRNFDTCQKC 138

  Fly  1078 -LIRP-------ATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGYL 1134
             ...|       :..:|.||...:.|..|.|                     .|.|...|     
  Fly   139 GKSEPKRGSGHKSNFLTCKGCMQKWHFPCLP---------------------ITFHNQST----- 177

  Fly  1135 QPKSVMPCD-VEGCRGFGNAKRFNLNVHALRECC-PYAPE----------------NWRQWRSKT 1181
             .:....|| ...|| ..|.:...|::.:|  |. .|.|:                |||.:|.:.
  Fly   178 -ARKKFKCDKCRYCR-LCNVRGPGLSICSL--CVDAYHPDCNDPTLKQSKAVEANPNWRCFRCEA 238

  Fly  1182 VKPPRVAPENIRRGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAKR-KTSPC-EEKVVK- 1243
            .        ||....:..::......|.....:.|.:.|.|:.:...:.|| ::.|. :||..| 
  Fly   239 C--------NIGGSTSASSEEQTGARKSTASREDQAQPVVPRKSNAGRKKRVQSEPTGQEKAAKI 295

  Fly  1244 -------------KQKQMQKEEDAEQVPDERSLAIARSFVKDYGPQFLPNYRL---WQLNSAFKL 1292
                         |:|:.:||||.|  |.:..:.:.:....|...:.:.|..|   .|.:.:.:|
  Fly   296 EKLAKRRQPLKTEKKKEYKKEEDEE--PAQIKVKVEKVEPVDMETEQIENNDLPGPEQESLSLRL 358

  Fly  1293 DDV-----RTNPLH-WTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVG 1351
            ..:     |::|:. |:...|.:::.:.....  |.|...|||||.:||:|.|.::.....||:|
  Fly   359 TPITAVERRSHPVSTWSVEQVVQFVAKRYPKE--ANVFRYQDIDGASLLLLNRHDVMNGFGLKLG 421

  Fly  1352 PAVKLYSLILNLRIAVVCKFDSKNIELESNTAG 1384
            ||::::.|:::|             :.:||..|
  Fly   422 PALRVFELVMSL-------------QTQSNDVG 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723 20/125 (16%)
SAM_PNT 1279..1366 CDD:280377 26/96 (27%)
CG2662NP_001284832.1 PHD 134..187 CDD:214584 13/80 (16%)
PHD 189..236 CDD:214584 12/50 (24%)
SAM_Atherin-like 371..438 CDD:188982 21/82 (26%)
SAM 371..436 CDD:197735 20/80 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12247
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.