DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and ph-p

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_476871.2 Gene:ph-p FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster

Alignment Length:1595 Identity:267/1596 (17%)
Similarity:492/1596 (31%) Gaps:509/1596 (32%)


  Fly    13 QLQRNISLSMSPANGGVISPSTANCNGVASA-SGGNPNPNSLLTLAPRKEELRFLPLAPM----- 71
            |.|..:...:|.||||          |.||| :||..:|.:......::.......::||     
  Fly   247 QQQLQLQQQLSEANGG----------GAASAGAGGAASPANSQQSQQQQHSTAISTMSPMQLAAA 301

  Fly    72 ----GGNKTCNITISNVQPMKSKLKSVNIV-------------PNSIKSAG-------------- 105
                ||:.|...|:..:||..|.|....||             |..:.:||              
  Fly   302 TGGVGGDWTQGRTVQLMQPSTSFLYPQMIVSGNLLHPGGLGQQPIQVITAGKPFQGNGPQMLTTT 366

  Fly   106 -------AGATVGSADAPLFQLVPSPSNPSQPLVA-----ILAPNRKTTLLGGGASNGQPVVI-- 156
                   .|...|.|.......:|:..|.|...|.     :::|.::..||...|:..|...:  
  Fly   367 TQNAKQMIGGQAGFAGGNYATCIPTNHNQSPQTVLFSPMNVISPQQQQNLLQSMAAAAQQQQLTQ 431

  Fly   157 ---------RSGTPLHKNSLTVETSNKPIQPGG--------------SAAAAAVGGGTGGAPLT- 197
                     :......:..||...:...:...|              ||..||.|.|:.|:..| 
  Fly   432 QQQQFNQQQQQQLTQQQQQLTAALAKVGVDAQGKLAQKVVQKVTTTSSAVQAATGPGSTGSTQTQ 496

  Fly   198 --------------------LVGKTVVPPKI--QAATPVQIPSTGPGAQVSL---LANP--LKPR 235
                                .|.::.:|..:  |:....|:.:.|...|:.:   |.|.  |:|.
  Fly   497 QVQQVQQQQQQTTQTTQQCVQVSQSTLPVGVGGQSVQTAQLLNAGQAQQMQIPWFLQNAAGLQPF 561

  Fly   236 AP---------------LILSKVAVDKLRLKFSQV------------KSNPNALVLGKANHVKKL 273
            .|               .|..:.|...|:.:.:|:            ::..:||. .|....::.
  Fly   562 GPNQIILRNQPDGTQGMFIQQQPATQTLQTQQNQIIQCNVTQTPTKARTQLDALA-PKQQQQQQQ 625

  Fly   274 LTSPNPSGEDK----TRSTQKNNKQNTSASQLKP--VVAPKTAMPI--ATEVPTADNNKMSLIKS 330
            :.:.|.:.:.:    |...|:..:|.|:|:..:|  .|.|.....:  |:.|.|......||:|:
  Fly   626 VGTTNQTQQQQLAVATAQLQQQQQQLTAAALQRPGAPVMPHNGTQVRPASSVSTQTAQNQSLLKA 690

  Fly   331 KPVAIKAVPLPSQEAPIVPAVAPVVTSPEKVD------------------------VKPTAKPSI 371
            |        :.:::.|:.||:|.:.|...:|.                        |.......:
  Fly   691 K--------MRNKQQPVRPALATLKTEIGQVAGQNKVVGHLTTVQQQQQATNLQQVVNAAGNKMV 747

  Fly   372 KTAPKPTPKPLEMSVNGPAKEKKAPAKEQKQKTMDKPPVVKEIAQHTPCGPKELPKLKRSKSFVS 436
            ..:...||..|:   ||........|...||:...:....::|.|......:::..::     :.
  Fly   748 VMSTTGTPITLQ---NGQTLHAATAAGVDKQQQQLQLFQKQQILQQQQMLQQQIAAIQ-----MQ 804

  Fly   437 NHPASPVANNERRHSVAIMAKEVDVIEQPSAAIETITIEDDDESEEEQQKPEIKKTPKQNQKPEK 501
            ...|:..|..:::..|: ..::|:..:|.:.|.:...:....:.:.|||: ::.:...|:|    
  Fly   805 QQQAAVQAQQQQQQQVS-QQQQVNAQQQQAVAQQQQAVAQAQQQQREQQQ-QVAQAQAQHQ---- 863

  Fly   502 QEAPKKKQIPMPILPAGITISTTSTAKKKAVRKNSSVTTISSSSSDSSSYSDVEV---VPTKKTE 563
            |......|..:.:.|.  ...|:...:::....|..:.......:.:...:.|:.   ...::.|
  Fly   864 QALANATQQILQVAPN--QFITSHQQQQQQQLHNQLIQQQLQQQAQAQVQAQVQAQAQQQQQQRE 926

  Fly   564 KELSMLPGISIIKAESLPLSREDFERSLRCDE---QVPQTPPKSSSSSSSGSHASEMSPPPKLA- 624
            ::.:::.  .|:..:|...|::..::......   |:...|...|||::....|:..:....|: 
  Fly   927 QQQNIIQ--QIVVQQSGATSQQTSQQQQHHQSGQLQLSSVPFSVSSSTTPAGIATSSALQAALSA 989

  Fly   625 ------DPKP----SSPPAKNAKKANDHDANPSPSSKT-NDFKKSMMQNLNMLKWRGQQPANLQN 678
                  ..||    ||.|..:.....:..:.|..:|.| ...:::..|:..:     .|...|.:
  Fly   990 SGAIFQTAKPGTCSSSSPTSSVVTITNQSSTPLVTSSTVASIQQAQTQSAQV-----HQHQQLIS 1049

  Fly   679 STVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSACVHPLLYLCQRCNFHGPAADFL 743
            :|:.....:          || |||           |...|:  .:|:|.:....|.........
  Fly  1050 ATIAGGTQQ----------QP-QGP-----------PSLTPT--TNPILAMTSMMNATVGHLSTA 1090

  Fly   744 APHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTA-----GTAPDLPQKRQTNYKPHKSLSAI 803
            .|...||            .||...|...:..|..||     |:.|..|.|...:..|..:|..|
  Fly  1091 PPVTVSV------------TSTAVTSSPGQLVLLSTASSGGGGSIPATPTKETPSKGPTATLVPI 1143

  Fly   804 QEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEIGMKLEAIDPENCSLFC 868
                     ..|:.|.        .|||...                         .|::.:...
  Fly  1144 ---------GSPKTPV--------SGKDTCT-------------------------TPKSSTPAT 1166

  Fly   869 VCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQD---IFPPGWCDETAR----VLQAPKDYNSERF 926
            |.:.||..           ||..:...|.|:.|   ....|....|::    .:|.|........
  Fly  1167 VSASVEAS-----------SSTGEALSNGDASDRSSTPSKGATTPTSKQSNAAVQPPSSTTPNSV 1220

  Fly   927 SWSRYLVKTGGKAAPR-ALFGHL----NMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDIL 986
            |         ||..|: |..|.|    :......:.||..|.        ..|....|:|.:...
  Fly  1221 S---------GKEEPKLATCGSLTSATSTSTTTTITNGIGVA--------RTTASTAVSTASTTT 1268

  Fly   987 DERIRVHFDGWDDCYDLWVHITSPYIHPCGWHEGRQQLIVPPDYQKSAFIWDDYISEVGGMAASK 1051
            ..                   :..:|..|               ..:.......||.     .||
  Fly  1269 TS-------------------SGTFITSC---------------TSTTTTTTSSISN-----GSK 1294

  Fly  1052 ELFTPRQPMEYQERMKLEVVDQRNPCLIRPATVVTR--KGYRVQLHLDCWPTEYYFWLEDDSPDL 1114
            :|  |:                   .:|:| .|:|.  .|:.:|...:.:|.....:.:.|..|.
  Fly  1295 DL--PK-------------------AMIKP-NVLTHVIDGFIIQEANEPFPVTRQRYADKDVSDE 1337

  Fly  1115 HPIGWCEATSHE------LETPPGYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPYAPEN 1173
            .|..  :||..|      :.:.||         .|:..|...|..:. ...:...|.|.|     
  Fly  1338 PPKK--KATMQEDIKLSGIASAPG---------SDMVACEQCGKMEH-KAKLKRKRYCSP----- 1385

  Fly  1174 WRQWRSKTVKPPRVAPENIRRGWAKKTKRA-------------------------CSEAKQAIKE 1213
                                 |.:::.|..                         .....:|:.|
  Fly  1386 ---------------------GCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEAMAE 1429

  Fly  1214 DSQQEIVYPKVAE---VVQAKRKTSPCEEKVVKKQKQMQKEEDAEQVPDERSLAIARSFVKDYG- 1274
            :..|....||::|   ::.|..:..|.                  .:|.:.:::.........| 
  Fly  1430 EKMQTEATPKLSESFPILGASTEVPPM------------------SLPVQAAISAPSPLAMPLGS 1476

  Fly  1275 ------PQFLPNYRLWQLNSAFKLDDVRTN---PL-HWTSWDVCEYIERALDSTDIAKVIFEQDI 1329
                  |...| ..:....:|.|..:|...   |: .|:..||..:|.......|......:|:|
  Fly  1477 PLSVALPTLAP-LSVVTSGAAPKSSEVNGTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEI 1540

  Fly  1330 DGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLR 1364
            ||:|||:|..|.|...:.:|:|||:|:.:.:.:::
  Fly  1541 DGQALLLLKEKHLVNAMGMKLGPALKIVAKVESIK 1575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 15/103 (15%)
MBT 929..1028 CDD:214723 14/104 (13%)
MBT 1038..1130 CDD:214723 19/100 (19%)
SAM_PNT 1279..1366 CDD:280377 25/91 (27%)
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 21/69 (30%)
SAM 1511..1576 CDD:197735 20/66 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C85979646
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12247
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.