DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Phc3

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_017446330.1 Gene:Phc3 RGDID:1307998 Length:1022 Species:Rattus norvegicus

Alignment Length:1339 Identity:243/1340 (18%)
Similarity:439/1340 (33%) Gaps:432/1340 (32%)


  Fly   125 SNPSQ-PLVAILAPNRKTTLLGGGASNGQ--PVVIRSGTPLHKNSLTVETSNKPIQPGGSAAAAA 186
            |.||. ..|:..|.:..||.:...:|..|  .:.:.||:..|...:..:..::|    .|:||..
  Rat    15 SEPSSGTSVSTTASSTTTTTITTSSSRMQQPQISVYSGSDRHAVQVIQQALHRP----PSSAAQY 75

  Fly   187 VGGGTGGAPLTLVGKTVV-------PPKIQAATPVQI------PSTGPGAQVSLLANPLKPRAPL 238
            :..........|:..|..       ..::|:...||.      |||.|...|:..:: :...:.|
  Rat    76 LQQMYAAQQQHLMLHTAALQQQHLSSSQLQSLAAVQASLSSGRPSTSPTGSVTQQSS-MSQTSDL 139

  Fly   239 ILSKVAVDKLRLKFSQV------KSNPNALVLGKANHVKKLLTSPNPSGEDKTRSTQKNNKQNTS 297
            ..||:.|.|:.|..|..      :|..::...|.......||.|.:|:      .|....:....
  Rat   140 RSSKLPVSKINLSTSPTPAQLMSRSQASSSTSGSITQQTMLLGSTSPT------LTASQAQMYLR 198

  Fly   298 ASQLKPVVAPKTAM-PIATEVPTADNNKMSLIKSKPVAIKAVPLPSQEAPIVPAVAPVVTSPEKV 361
            |..|  :..|.|.: .:.:::|...::.....:|....::.:.|.||:       ..|::|.:..
  Rat   199 AQML--IFTPATTVAAVQSDIPVVSSSPSPSCQSAAAQVQNLTLRSQK-------LGVLSSSQNG 254

  Fly   362 DVKPTAKPSIKTA--PKPTPKPLEMSVNGPAKEKK---APAKEQKQKTMDKPPVVKEI---AQHT 418
            ..|...:....|.  .|.|....::|...|:.|.|   :|..|.:...:.:...:.::   |.::
  Rat   255 PPKSAGQTQSLTICHNKTTVTSSKISQRDPSPESKKGGSPGLESRSTAVTRTSSIHQLIAPASYS 319

  Fly   419 PCGPKELPKLKRSKSFVSNHPASPVANNERRHSVAIMAKEVDVIEQPSAAIETITIEDDDESEEE 483
            |..|..|.|.::    :..|...|..::   |.:        :::|....|:.||:         
  Rat   320 PIQPHSLIKHQQ----IPLHSPPPKVSH---HQL--------ILQQQQQQIQPITL--------- 360

  Fly   484 QQKPEIKKTPKQNQKPEKQEAPKKKQIPMP---ILPAGITISTTSTAKKK----AVRKNSSVTTI 541
                         |.|.:...|.:..||:|   :.||      :|.|:.:    .::.:....|:
  Rat   361 -------------QSPSQDPPPSQHCIPLPNHGLSPA------SSNAQSQQHCSPIQSHPPPLTV 406

  Fly   542 SSSSSDSSSYSDVEVVPTKKTEKELSMLPGISIIKAESLPLSREDFERSLRCDEQVPQTPPKSSS 606
            |.|.:.|:..|   ||.:.......|..|.| ||..::|                 .|..|..||
  Rat   407 SPSQAQSAQQS---VVVSPPPAHSPSQSPTI-IIHPQAL-----------------VQPHPLVSS 450

  Fly   607 SSSSGSH-----------ASEMSPPPKLADPKPSSP-----PAKNAKKANDHDANPSPSSKTNDF 655
            :..:|.:           .::::.|..|  |.|:||     |.:.:...:......||:|.    
  Rat   451 ALHTGPNLQQATADQVQSTAQLNLPSHL--PLPASPVVHIGPVQQSALVSPGQQIVSPTSH---- 509

  Fly   656 KKSMMQNLNMLKWRGQQPANLQNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPS 720
                           ||.:.||:|.:..             ..|.|..|:             |.
  Rat   510 ---------------QQYSTLQSSPIPI-------------ATPPQMSAS-------------PP 533

  Fly   721 ACVHPLLYLCQRCNFHGPAADFLAPHFCSVGCVRRSQKRRLPQSTQKESKI---SRTQLEQTAGT 782
            |.:.||           |....                    ||.|.:.:|   .:..::....:
  Rat   534 AQIPPL-----------PLQSM--------------------QSLQVQPEILSQGQVLVQNALVS 567

  Fly   783 APDLPQKRQTNYKPHKSLS-----AIQEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPIHLFLNP 842
            ..:||........|.::|.     |:..|:|.                                |
  Rat   568 EEELPAAEALVQLPFQTLPPPQTVAVNLQVQP--------------------------------P 600

  Fly   843 FPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGW 907
            .|:.|   .:||.|     ..|.|..|.|:   :.|:::                |..:...|..
  Rat   601 APVDP---PVGMHL-----NQCHLHKVFSL---KVYQVE----------------DVCEEERPEE 638

  Fly   908 CDETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLN 972
            .||.||:.:.|..                ...:|.|    :.:.:..|:.:...:   ||..:|.
  Rat   639 SDECARMDRTPPP----------------PTLSPAA----ITVGRGEDLTSEHPL---LEQVELP 680

  Fly   973 DTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITS---PYIHPCGWHEGRQ------------ 1022
            ....:..:.:....|.                .|:::   |.:.|........            
  Rat   681 AVASVSASVIKSPSDP----------------THVSAPAPPLLMPAASTRSSSTSLASSTPSLEN 729

  Fly  1023 ---QLIVPPDYQKSAFIWDDYISEVG--GMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPA 1082
               |.||.|  |....:.:.::.:.|  ....|:......||::.:..:..:||   |...::|.
  Rat   730 KPPQAIVKP--QILTHVIEGFVIQEGLEPFPVSRSSLLIEQPVKKRPLLDNQVV---NSVCVQPE 789

  Fly  1083 TVVTRKGYRVQLHLD-CWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGYLQPKSVMPCDVEG 1146
            .....|      |.| ...||    :||..        .|.|..|:::        .::.|:..|
  Rat   790 LQNNTK------HADNSSDTE----MEDMI--------AEETLEEMDS--------ELLKCEFCG 828

  Fly  1147 CRGFGN-------------AKRFNLNVHALRECC-PYAPENWRQWRSKTVKPPRVAPENIRRGWA 1197
            ..|:.|             |||:|::      |. .:|...|.:           .|:|...|  
  Rat   829 KMGYPNEFLRSKRFCTMSCAKRYNVS------CSKKFALSRWNR-----------KPDNQSLG-- 874

  Fly  1198 KKTKRACSEAKQAIKED--SQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQMQKEEDAEQVPDE 1260
             ...|..|..:.|.:|.  .|..|.||...|.:.::....| .....:.::|.::|.:.|     
  Rat   875 -HRGRRPSGPEGAAREHILRQLPITYPSAEEDLASRDDPVP-SAMTTRLRRQSERERERE----- 932

  Fly  1261 RSLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTDIAKVIF 1325
                     ::|...:.:|.      ||.. |...:|.|..||..||..:|.......|:|....
  Rat   933 ---------LRDVRIRKMPE------NSDL-LPVAQTEPSIWTVDDVWAFIHSLPGCQDVADEFR 981

  Fly  1326 EQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLR 1364
            .|:|||:|||:|....|.:.:.:|:|||:|:.:.|.:|:
  Rat   982 AQEIDGQALLLLKEDHLMSTMNMKLGPALKICARINSLK 1020

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 17/96 (18%)
MBT 929..1028 CDD:214723 13/117 (11%)
MBT 1038..1130 CDD:214723 18/95 (19%)
SAM_PNT 1279..1366 CDD:280377 29/87 (33%)
Phc3XP_017446330.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.