DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Sfmbt2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_006254272.1 Gene:Sfmbt2 RGDID:1305027 Length:890 Species:Rattus norvegicus

Alignment Length:913 Identity:190/914 (21%)
Similarity:306/914 (33%) Gaps:325/914 (36%)


  Fly   758 KRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQEQLQQRQKDKPRKPFRWS 822
            :||||   ..:.:.|.:.||:.  |:|:         ..:.||...::..|:..:      |.|.
  Rat     2 ERRLP---VLKIRTSSSSLERI--TSPE---------NGNGSLDTEEDSRQEETE------FSWG 46

  Fly   823 EYLKSKGKDVAAPIHLFLNPFPIS-PNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDG 886
            :||...|.. |.| |:......|| .:.|:.|||||..:..:...:.|.:|:...|..|.|.:.|
  Rat    47 DYLDETGAR-AVP-HVCFRHVEISIQSNFQPGMKLEVANKNHPDTYWVATIITTCGQLLLLRYCG 109

  Fly   887 YSS--MYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVK--TGGKAAPRALF-G 946
            |..  ..|||.:....|:.|.|||.:..:||:.|.....:...|..:|:.  ||.:.||.:|. |
  Rat   110 YGEDRRADFWCDVIIADLHPVGWCTQNNKVLRPPDAIKEKYADWEEFLIHELTGSRTAPASLLEG 174

  Fly   947 HLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWD--DCYDLWVHITS 1009
            .|..:..:|:   ..|...:|.:|..:..:..:.:|.:.:..|:|:.:.|.:  :.||.|:....
  Rat   175 PLRGKGPIDL---ITVDSLIELQDSQNPFQYWIVSVIENVGGRLRLRYVGLEHTESYDRWLFYLD 236

  Fly  1010 PYIHPCGWHEGRQQLIVPPD---YQKSAFIW---------------------------------- 1037
            ..:.|.||.:.::..:.||.   |.|..|.|                                  
  Rat   237 YRLRPIGWCQEKKYRMDPPSELYYLKLPFEWKCALEKALLAAAECPLPMEVFKDHADLGSHFFTV 301

  Fly  1038 ---------------------------------DDYISEVGGMA----ASKELFTPRQ------- 1058
                                             ||..:|..|:.    |......|.|       
  Rat   302 GMRLETLHINDPFHIYPATVTKVFNSQFFQVAIDDLRAETNGLTMLCHADSLGILPVQWCLKNGV 366

  Fly  1059 ----PMEYQ--------------------------------ERMKLEVVDQRNPCLIRPATVVTR 1087
                |..|.                                :.||||.|:.:||..:..|||::.
  Rat   367 NLAPPKGYSGQDFNWVDYHKQREAEGAPPYCFKNTFARGFAKNMKLEAVNPKNPGEVCVATVISV 431

  Fly  1088 KGYRVQLHLDCWPTEYYFWLED-DSPDLHPIGWCEATSHELETP----------PGYLQPK--SV 1139
            :|..:.|.|:...|.....:.| ||.|:.|:|||||.|:.|.||          |..:.|:  |:
  Rat   432 RGSLLWLRLEGVETPMPEIIVDIDSMDIFPVGWCEANSYPLTTPYKSSSKSKKKPITVPPEKPSL 496

  Fly  1140 MPCDVEG-------------CRGFGNAK------------------------------------- 1154
            .|..||.             ..|..|.|                                     
  Rat   497 PPVPVENIPQELCLPPQTDTAAGAANEKYYCPQLFVNHRCFSGPFLNKGRISELPQSVGPGKCVL 561

  Fly  1155 -------------------------------------------------------------RFNL 1158
                                                                         .|..
  Rat   562 VLKEILTMITNAAYKPGRVLRELQLVEDPEWDFQEEVLKAKYRGKIYRAVVKIVRTADQVTSFCQ 626

  Fly  1159 NVHALRECCP----------YAPEN-----------WRQWRSKTVKPP------RVAPENIRRGW 1196
            .|.|..||||          ..|||           :...|.:.:|||      ..||:..||..
  Rat   627 QVCAKLECCPNLFSPLLISENCPENCSIRTKTKYTYYYGKRKRIIKPPLGESNTESAPKPTRRRK 691

  Fly  1197 AKKT-----KRACS------EAKQAIKEDSQQ--EIVYPKVAEVVQ-AKRKTSPCEEKVVKKQKQ 1247
            .:|:     ||..|      .:.|..:||..:  :....:...||| .|.:..|.|....:.|:.
  Rat   692 RRKSIYVQKKRKSSAVAMPATSAQETEEDDPEALDTASEETGYVVQNYKTQHVPVEMPFTRSQRA 756

  Fly  1248 M--QKEEDA-EQVPDERSLAI--ARSFVKDYGPQFLPNYRLWQLNSAFKLDD----VRTNPLHWT 1303
            |  :|...| :..|.||:..:  ..|.........:|..|:.:.....:.::    :.:|||.|:
  Rat   757 MILRKHSGAVKHPPVERARRVRSVHSTASSNNRNKVPLVRIEKSEDPRQSEEEKLILESNPLEWS 821

  Fly  1304 SWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLRIAVV 1368
            ..||..:| :..|...:|::..||||||:|||:|....:...::||:|||:||...|..:::|..
  Rat   822 VTDVVRFI-KLTDCAPLARIFQEQDIDGQALLLLTLPTVQECMELKLGPAIKLCHQIERVKVAFY 885

  Fly  1369 CKF 1371
            .::
  Rat   886 AQY 888

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 31/99 (31%)
MBT 929..1028 CDD:214723 23/104 (22%)
MBT 1038..1130 CDD:214723 36/140 (26%)
SAM_PNT 1279..1366 CDD:280377 29/91 (32%)
Sfmbt2XP_006254272.1 MBT 47..143 CDD:214723 31/98 (32%)
MBT 154..255 CDD:214723 23/104 (22%)
MBT 281..371 CDD:214723 7/90 (8%)
MBT 383..475 CDD:214723 27/92 (29%)
DUF3588 527..641 CDD:288954 7/114 (6%)
SAM_Scm-like-4MBT1,2 807..890 CDD:188980 28/84 (33%)
SAM 817..881 CDD:197735 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86669790
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.