DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and L3mbtl2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_008763933.1 Gene:L3mbtl2 RGDID:1308569 Length:728 Species:Rattus norvegicus

Alignment Length:744 Identity:154/745 (21%)
Similarity:262/745 (35%) Gaps:241/745 (32%)


  Fly   621 PKLADPKPSSPPAKNAKKANDHDA------------NPSPSSKTNDFKKSMMQNLNMLKWRGQQP 673
            |:..:..|||.|   .::..|.|.            |.|..|:::.:.:...:..|..:..|:.|
  Rat     4 PRGTEETPSSEP---MEEEEDDDLELFGGYDSFRSYNSSAGSESSSYLEESSEAENEDREAGELP 65

  Fly   674 ANLQNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSACVHPLLYLCQRCNFHGP 738
                  |....|    |...|.|.              .|..|..|:        :|:.|...|.
  Rat    66 ------TSPLHL----FSSANNRA--------------LDGSGSEPA--------VCEMCGIVGT 98

  Fly   739 AADFLA--PHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKS-- 799
            ...|.:  ..||||.|     .|....:::|.|.::|.|     |..|  .:|.:..:|...|  
  Rat    99 REAFFSKTKRFCSVSC-----SRSYSSNSKKASILARLQ-----GKPP--TKKAKVLHKAAWSAK 151

  Fly   800 LSAIQEQLQQRQ--------KDKPRKPFRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEI--GM 854
            :.|........|        :|.....|.|.::||..... |||:..|.: .|:.....::  ||
  Rat   152 IGAFLHAQGTGQLADGTPTGQDALVLGFDWGKFLKDHSYK-AAPVGCFKH-VPLYDQWEDVMKGM 214

  Fly   855 KLEAIDPE---NCSLFCVCSIVEVRGYRLKLSFDGY--SSMYDFWVNADSQDIFPPGWCDETARV 914
            |:|.::.:   ...::.:.::::..|||:.|.::|:  .:.:|||.|..:.|:.|.|||...:::
  Rat   215 KVEVLNSDAVLPSRVYWIATVIQAAGYRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKI 279

  Fly   915 LQAPKDYNSERFSWSRYLVK--TGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKI 977
            |..|:..:::...|..||:|  .|.:..|...  |:.|.:.|  :..|..||.||..|.....:.
  Rat   280 LVPPRTIHAKFTDWKSYLMKRLVGSRTLPADF--HIKMVESM--KYPFRQGMRLEVVDKTQVSRT 340

  Fly   978 CVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGW------------------------- 1017
            .:|.|..::..|:|:.::..|...|.|.|:.||.|||.||                         
  Rat   341 RMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSERRCDMSHHPTFRK 405

  Fly  1018 -----------------------HEGRQ------------------------------------- 1022
                                   .||.:                                     
  Rat   406 IYCDAVPYLFKKVRAVYTEGGWFEEGMKLEAIDPLNLGNICVATICKVLLDGYLMICVDGGPSTD 470

  Fly  1023 -------------------------QLIVPPDYQKSAFIWDDYISEVGGMAASKELFTPRQPME- 1061
                                     :|..|..|:...|.|:.|:.:....||...||....|.. 
  Rat   471 GSDWFCYHASSHAIFPATFCQKNDIELTPPKGYETQPFDWESYLEKTKSKAAPARLFNMDCPNHG 535

  Fly  1062 YQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHE 1126
            ::..||||.||...|.||..|||.......:.:|.|.|..||..|::.:|||::|:||||.|.::
  Rat   536 FKVGMKLEAVDLMEPRLICVATVKRVVHRLLSIHFDGWDNEYDQWVDCESPDIYPVGWCELTGYQ 600

  Fly  1127 LETPPGYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPYAPENWRQWRSKTVKPPRVAPEN 1191
            |: ||...:|.:                                |:..:.           |.:.
  Rat   601 LQ-PPVSAEPNT--------------------------------PQKGKD-----------ATKK 621

  Fly  1192 IRRGWAKKTKRACSEAKQAIKEDSQQEIV 1220
            .::.:.||.||..|...:.:::.|::.::
  Rat   622 KKKQFGKKRKRIPSAKTRPLRQSSKKPLL 650

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 26/103 (25%)
MBT 929..1028 CDD:214723 33/211 (16%)
MBT 1038..1130 CDD:214723 34/93 (37%)
SAM_PNT 1279..1366 CDD:280377
L3mbtl2XP_008763933.1 MBT 183..283 CDD:214723 26/102 (25%)
MBT 294..390 CDD:214723 29/100 (29%)
MBT 433..504 CDD:280910 3/71 (4%)
MBT 511..604 CDD:214723 35/94 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.