DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Scmh1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001153102.1 Gene:Scmh1 MGIID:1352762 Length:706 Species:Mus musculus

Alignment Length:684 Identity:155/685 (23%)
Similarity:239/685 (35%) Gaps:197/685 (29%)


  Fly   815 PRKPFRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYR 879
            |...|.|.:||| :...|.||:|.|...:....|.|:|.|||||.||.|.:..|:.::|.:.|.|
Mouse    24 PLGHFTWDKYLK-ETCSVPAPVHCFKQSYTPPSNEFKISMKLEAQDPRNTTSTCIATVVGLTGAR 87

  Fly   880 LKLSFDGYSSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKT--GGKAAPR 942
            |:|..||..:..|||...||.:|.|.|.|::...:||.|..:.....||..:|:||  |.:.||.
Mouse    88 LRLRLDGSDNKNDFWRLVDSSEIQPIGNCEKNGGMLQPPLGFRLNASSWPMFLLKTLNGAEMAPI 152

  Fly   943 ALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHI 1007
            .:|   :.:......|.|.:||.|||.|..:...||.||:.::....:.|.||||...:|.|...
Mouse   153 KIF---HKEPPSPSHNFFKMGMKLEAVDRKNPHFICPATIGEVRGAEVLVTFDGWRGAFDYWCRF 214

  Fly  1008 TSPYIHPCGW--------HEGRQQLIVP-------------PDYQKSAFIWDDYISEVGGMAASK 1051
            .|..|.|.||        .....::::|             |....:..:.:....:.|.....|
Mouse   215 DSRDIFPVGWCSLTGDNLQPPGTKVVIPKNPSPSSDVSTEKPSIHSTKTVLEHQPGQRGRKPGKK 279

  Fly  1052 ELFTPR--------------QPMEYQERMKLEVVDQRNP--CLIRPATVVTRKGYRVQLHLDCWP 1100
            ...||:              :|:::.::...:...:|.|  .|..|.|..|              
Mouse   280 RGRTPKILIPHPTSTPSKSAEPLKFPKKRGPKPGSKRKPRTLLSPPPTSPT-------------- 330

  Fly  1101 TEYYFWLEDDSPDLHPIGWCEATSHELETPPGYLQPKSVMPC---DVEGCRG------------- 1149
                  .....||...:....||     .|...:|..:|  |   :..|..|             
Mouse   331 ------TSTPEPDTSTVPQDAAT-----VPSSAMQAPTV--CIYLNKSGSTGPHLDKKKIQQLPD 382

  Fly  1150 -FGNAKRFNLNVHALREC--CPYAPENWRQWRSKTVKPPRVAPENIRRGWAKKTKRACSEAKQAI 1211
             ||.|:...:...|::.|  |.|        ..|||.      ..:::|..       .|...|:
Mouse   383 HFGPARASVVLQQAVQACIDCAY--------HQKTVF------SFLKQGHG-------GEVISAV 426

  Fly  1212 KEDSQQEIVYPKVAEVVQAKR---------------KTSPCEEKVVKKQKQMQKEEDAEQVPDER 1261
            .:..|..:..|.|..:....|               ...|..:..:..............:|.|.
Mouse   427 FDREQHTLNLPAVNSITYVLRFLEKLCHNLRSDNLFGNQPFTQTHLSLTATEYNHNHDRYLPGET 491

  Fly  1262 SL---AIARSF------------------------VKDYGPQFLPNYRL---------------- 1283
            .:   ::|||.                        ...|.| .||:..|                
Mouse   492 FVLGNSLARSLETHSDLMDSALKPANLVSTSQNLRTPGYRP-LLPSCGLPLSTVSAVRRLCSKGV 555

  Fly  1284 -------------WQLNSA-------FKLDDVR---TNPLHWTSWDVCEYIERA---LDSTDIAK 1322
                         |:||.:       ...|..|   .:|..||..||.:::..|   |.|.  |.
Mouse   556 LKGKKERRDVESFWKLNHSPGSDRHLESRDPPRLSGRDPSSWTVEDVMQFVREADPQLGSH--AD 618

  Fly  1323 VIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKL 1356
            :..:.:|||:|||:|....:..|:.||:|||:||
Mouse   619 LFRKHEIDGKALLLLRSDMMMKYMGLKLGPALKL 652

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 38/96 (40%)
MBT 929..1028 CDD:214723 32/122 (26%)
MBT 1038..1130 CDD:214723 15/108 (14%)
SAM_PNT 1279..1366 CDD:280377 31/121 (26%)
Scmh1NP_001153102.1 MBT 1 28..126 40/99 (40%)
MBT 31..126 CDD:214723 38/96 (40%)
MBT 2 134..235 33/104 (32%)
MBT 137..235 CDD:214723 31/101 (31%)
DUF3588 357..465 CDD:288954 21/131 (16%)
SAM_Scm 591..661 CDD:188977 24/65 (37%)
SAM 594..661 CDD:197735 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86873334
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.