DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and L3MBTL1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_115479.4 Gene:L3MBTL1 HGNCID:15905 Length:840 Species:Homo sapiens

Alignment Length:916 Identity:258/917 (28%)
Similarity:385/917 (42%) Gaps:213/917 (23%)


  Fly   569 LPGIS-IIKAES----LPLSRED---FERS---LRCDEQV-----------PQTPPKSSSSSSSG 611
            ||..: ||.|.|    ||.|..|   |.|.   :...|||           ||.....:|||:|.
Human    15 LPATAFIIPASSATLGLPSSALDVSCFPREPIHVGAPEQVAGCEPVSATVLPQLSAGPASSSTST 79

  Fly   612 SHASE----MSPPP------KLADPKP------SSPPAKNAKK------------ANDHDANPSP 648
            ....|    .:|||      ::::.||      ..||:...::            |.|.:|.|  
Human    80 VRLLEWTEAAAPPPGGGLRFRISEYKPLNMAGVEQPPSPELRQEGVTEYEDGGAPAGDGEAGP-- 142

  Fly   649 SSKTNDFKKSMMQNLNMLKWRGQQPANLQNSTVRFELNEFNFLQINERCQPRQ--GPAAYFERPL 711
             .:..|..::..::.|      |.|.. .:||.:.           :.|.|.|  ||..      
Human   143 -QQAEDHPQNPPEDPN------QDPPE-DDSTCQC-----------QACGPHQAAGPDL------ 182

  Fly   712 YDRPGRRPSACVHPLLY-----LCQRCNFHGPAADFLAPHFCSVGCVRRSQKRRLPQSTQKESKI 771
                |.....|  |.|:     :.:..:....|::.|.|        .:.:|||..||..:|.  
Human   183 ----GSSNDGC--PQLFQERSVIVENSSGSTSASELLKP--------MKKRKRREYQSPSEEE-- 231

  Fly   772 SRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQEQLQQRQKDKP-----RKPFRWSEYLKSKGKD 831
                      :.|:..:|::....|....:|...:.::....:|     ::.:.|..||:.: |.
Human   232 ----------SEPEAMEKQEEGKDPEGQPTASTPESEEWSSSQPATGEKKECWSWESYLEEQ-KA 285

  Fly   832 VAAPIHLFLNPFPI--SPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFW 894
            :.||:.||.:...:  :.|.|::|||||.|||::.|::.:.::.||.||||:|.|||||..:|||
Human   286 ITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFW 350

  Fly   895 VNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNG 959
            |||:|.||.|.||.::|...||.||.|..|.||||:||..|..:|||:.||   ..|.......|
Human   351 VNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLF---VSQSHSPPPLG 412

  Fly   960 FAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGWHEGRQQL 1024
            |.|||.|||.|..:...:|||:|||::|.|..||||.|||.||.|...:||||||.||.:.:.:.
Human   413 FQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKP 477

  Fly  1025 IVPP-DY-QKSAFIWDDYISEVGGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPATVVTR 1087
            :.|| || ....|.|:.|:.|.|..|.....|..|.|..:...||||.||:|||.|||.|:|...
Human   478 LTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDV 542

  Fly  1088 KGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGYLQPKSVMP----------- 1141
            :.:|:::|.|.|...|.||::.|.||:||.|||..|.|.|:.|.|..:|.|..|           
Human   543 EDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSASPGGCPPLSYRSL 607

  Fly  1142 --------------CDVEGCRGFGNAKRFNLNVHALRECCPYAPENWRQW-----------RSKT 1181
                          |...||.|.|:... ....|.....||.|..|..:.           |.|.
Human   608 PHTRTSKYSFHHRKCPTPGCDGSGHVTG-KFTAHHCLSGCPLAERNQSRLKAELSDSEASARKKN 671

  Fly  1182 VK--PPRVAPENIRR-GWAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVK 1243
            :.  .||..|.:..| |...|.::...|..|.:..|...:.::.. |......|..|.|      
Human   672 LSGFSPRKKPRHHGRIGRPPKYRKIPQEDFQTLTPDVVHQSLFMS-ALSAHPDRSLSVC------ 729

  Fly  1244 KQKQMQKEEDAEQVPDERSLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPLHWTSWDVC 1308
                  .|:..:.:|....:: |.:..|            |.::..|......|.         |
Human   730 ------WEQHCKLLPGVAGIS-ASTVAK------------WTIDEVFGFVQTLTG---------C 766

  Fly  1309 EYIERALDSTDIAKVIFEQDIDGRALL----MLGRKELDTYLK-----LKVGPAVKLYSLILNLR 1364
            |  ::|....|.|:::....:.|:.|:    .||......:|:     |:.|    ::||:.:|.
Human   767 E--DQARLFKDEARIVRVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETG----VHSLLCSLP 825

  Fly  1365 IAVVCK 1370
            ..::.|
Human   826 THLLAK 831

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 45/98 (46%)
MBT 929..1028 CDD:214723 46/99 (46%)
MBT 1038..1130 CDD:214723 39/92 (42%)
SAM_PNT 1279..1366 CDD:280377 18/96 (19%)
L3MBTL1NP_115479.4 DNA_pol3_gamma3 <5..166 CDD:331207 38/161 (24%)
MBT 1 274..374 46/101 (46%)
MBT 277..374 CDD:214723 45/98 (46%)
MBT 2 382..481 49/102 (48%)
MBT 385..481 CDD:214723 46/99 (46%)
Interaction with monomethylated and dimethylated peptides 447..454 5/7 (71%)
MBT 3 490..585 41/95 (43%)
MBT 493..585 CDD:214723 39/92 (42%)
zf-C2HC 621..649 CDD:307601 8/29 (28%)
SAM_superfamily 748..>776 CDD:326639 8/51 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87059173
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T609620
orthoMCL 1 0.900 OOG5_130415
Panther 1 1.100 O PTHR12247
Phylome 1 0.910 0.771 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5341
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.