DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and SCML4

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_016866166.1 Gene:SCML4 HGNCID:21397 Length:442 Species:Homo sapiens

Alignment Length:685 Identity:130/686 (19%)
Similarity:199/686 (29%) Gaps:317/686 (46%)


  Fly   725 PLLYLCQRCNFHGPAADFLAPHFCSVGCVR----RSQKRRLPQSTQKESKISRTQLEQ------- 778
            |||          |.:| |:||     .||    ..|.:|:|...:....:..|.::.       
Human    10 PLL----------PVSD-LSPH-----SVRLAPAEMQSQRIPGRKRGRPSLHSTPMKMAVHNLYS 58

  Fly   779 -TAGTAP--DLPQKRQTNYKPHKSLSAIQEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPIHLFL 840
             :||:.|  .:|:||                        .|||   ...:||:         :.:
Human    59 ASAGSLPAVKIPKKR------------------------GRKP---GYKIKSR---------VLM 87

  Fly   841 NPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPP 905
            .|..:||........|.:| |::.:  .|.|:...:...:.|           ::|..:.    .
Human    88 TPLALSPPRSTPEPDLSSI-PQDAA--TVPSLAAPQALTVCL-----------YINKQAN----A 134

  Fly   906 GWCDETARVLQAPKDYNSER----------------------FSWSRYLVKTGGKAAPRALFGHL 948
            |...|..:|.|.|:.:..||                      ||    |||.|        :|  
Human   135 GPYLERKKVQQLPEHFGPERPSAVLQQAVQACIDCAHQQKLVFS----LVKQG--------YG-- 185

  Fly   949 NMQQQMDVRNGFAVGMHLEA-EDLNDTG-------KICVATVTDILDERIRVHFDGWDDCYDLWV 1005
              .:.:.|...|....||.: ..:|..|       |:|.:.:                 |.||:.
Human   186 --GEMVSVSASFDGKQHLRSLPVVNSIGYVLRFLAKLCRSLL-----------------CDDLFS 231

  Fly  1006 HITSPYIHPCGWHEGRQQLIVPPDYQKSAFIWDDYISEVGGMAASKELFTPRQPMEYQERMKLEV 1070
            |  .|:...|...|..|:                  .|.|.|.:.|.:.|.    ||        
Human   232 H--QPFPRGCSASEKVQE------------------KEEGRMESVKTVTTE----EY-------- 264

  Fly  1071 VDQRNPCLIRPA--------TVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHEL 1127
                   |:.|.        |..:...:|..||    |:...:....:|.|.|..|...||:...
Human   265 -------LVNPVGMNRYSVDTSASTFNHRGSLH----PSSSLYCKRQNSGDSHLGGGPAATAGGP 318

  Fly  1128 ETPPGYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPYAPENWRQWRSKTVKPPRVAPENI 1192
            .|.|                               :....|.||         .::||..:|:  
Human   319 RTSP-------------------------------MSSGGPSAP---------GLRPPASSPK-- 341

  Fly  1193 RRGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQMQKEEDAEQV 1257
            |...:.:..|..|...|    |:|            .|:|..|              :...|..|
Human   342 RNTTSLEGNRCASSPSQ----DAQ------------DARRPRS--------------RNPSAWTV 376

  Fly  1258 PDERSLAIARSFVKDYGPQFL-PNYRLWQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTDIA 1321
            .|      ...||||..||.| |:..|::                                    
Human   377 ED------VVWFVKDADPQALGPHVELFR------------------------------------ 399

  Fly  1322 KVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKL 1356
                :.:|||.|||:|....:..||.||:|||:||
Human   400 ----KHEIDGNALLLLKSDMVMKYLGLKLGPALKL 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 16/96 (17%)
MBT 929..1028 CDD:214723 21/107 (20%)
MBT 1038..1130 CDD:214723 21/100 (21%)
SAM_PNT 1279..1366 CDD:280377 18/79 (23%)
SCML4XP_016866166.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87387332
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.