DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Phc3

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_006535530.1 Gene:Phc3 MGIID:2181434 Length:1009 Species:Mus musculus

Alignment Length:1298 Identity:225/1299 (17%)
Similarity:408/1299 (31%) Gaps:374/1299 (29%)


  Fly   141 TTLLGGGASNGQPVVIRSGTPLHKNSLTVETSNKPIQPGGSAAAAAVGGGTGGAPLTLVGKTVVP 205
            :|.:....|:|..|   |.|.....:.|:.||:..:|    ....:|..|:....:.::.:.:..
Mouse    10 STAMDSEPSSGTSV---STTASSTTTTTITTSSSRMQ----QPQISVYSGSDRHAVQVIQQALHR 67

  Fly   206 PKIQAATPVQIPSTGPGAQVSLLANPLKPRAPLILSKVAVDKLRLKFSQVKSNPNALVLGKANHV 270
            |...||..:|          .:.|   ..:..|:|...|:.:..|..||::|         ...|
Mouse    68 PPSSAAQYLQ----------QMYA---AQQQHLMLHTAALQQQHLSSSQLQS---------LAAV 110

  Fly   271 KKLLTSPNPSGEDKTRSTQKNNKQNTSASQLKPVVAPKTAMPIATEVPTADNNKMSLIKSKPVAI 335
            :..|:|..||.......||:::...||.....|  ||...|           |:.....|...:|
Mouse   111 QASLSSGRPSTSPTGSVTQQSSMSQTSILSASP--APAQLM-----------NRSQTSSSTSGSI 162

  Fly   336 KAVPLPSQEAPIVPAVAPVVTSPEKVDVKPTAKPSIKTAPKPTPKPLEMSVNGPAKEKKAPAKEQ 400
                  :|:..::.:.:|.:|:.:       |:..::.         :|.:..||....|.    
Mouse   163 ------TQQTMLLGSTSPTLTASQ-------AQMYLRA---------QMLIFTPATTVAAV---- 201

  Fly   401 KQKTMDKPPVVKEIAQHTPCGPKELPKLKRSKSFVSNHPASPVAN-NERRHSVAIMAKEVDVIEQ 464
                                 ..::|.:..|.|......|:.|.| ..|...:.:::...:...:
Mouse   202 ---------------------QSDIPVVSSSPSPSCQSAAAQVQNLTLRSQKLGVLSSSQNGSPK 245

  Fly   465 PSAAIETITIEDDDESEEEQQKPEIKKTPKQNQKPEKQEAPKKKQIPMPILPAGITISTTSTAKK 529
            .:...:::||..:            |.|...::..::..:|:.|:...|.|          .::.
Mouse   246 SAGQTQSLTICHN------------KTTVTSSKISQRDPSPESKKGGSPGL----------ESRS 288

  Fly   530 KAVRKNSSVTTISSSSSDSSSYSDVEVVPTKKTEKELSMLPGISIIKAESLPLSREDFERSLRCD 594
            .||.:.||:..:.:    .:|||.::              |. |:||.:.:||.           
Mouse   289 TAVTRTSSIHQLIA----PASYSPIQ--------------PH-SLIKHQQIPLH----------- 323

  Fly   595 EQVPQTPPKSSSSSSSGSHASEMSPPPKLADPKPSSPPAKNAKKANDHDANPSPSSKTNDFKKSM 659
                ..|||.|..........:...|..|..|....||:::.....:|..:|:||:........:
Mouse   324 ----SPPPKVSHHQLLLQQQQQQIQPITLQSPSQDPPPSQHCIPLPNHGLSPAPSNAQPQHCSPV 384

  Fly   660 MQNLNMLKWRGQQPANLQNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSACVH 724
            ..:...|.....|..:.|.|.|                         ...|....|.:.|:..:|
Mouse   385 QSHPPPLTVSPNQAQSAQQSVV-------------------------VSPPPPHSPSQSPTIIIH 424

  Fly   725 PLLYLCQRCNFHGPAADFLAPHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAP-DLPQ 788
            |              ...:.||            ..:..:.|....:.:...:|...||. :||.
Mouse   425 P--------------QALIQPH------------PLVSSALQTGPNLQQAAADQVQSTAQLNLPS 463

  Fly   789 KRQTNYKPHKSLSAIQEQLQQRQKDKPRKPFRWSEY--LKSKGKDVAAPIHLF------LNPFPI 845
            .......|...:..:|:........:...|....:|  |:|....:|.|..:.      |.|.|:
Mouse   464 HLPLPASPVVHIGPVQQSALVSPGQQMVSPTSHQQYSALQSSPIPIATPPQMSASPPAQLPPLPL 528

  Fly   846 SPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDE 910
            .      .|:...:.||..|                                             
Mouse   529 Q------SMQSLQVQPEILS--------------------------------------------- 542

  Fly   911 TARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTG 975
            ..:||......:.|....:..||:...:..|......:|:|.|........|||||....|:...
Mouse   543 QGQVLVQNALVSEEELPAAEALVQLPFQTLPPPQTVAVNLQVQPPAPVDPPVGMHLNQCHLHKVF 607

  Fly   976 KICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGWHEGR-----------QQLIVPPD 1029
            .:.|..|.|:.:|.:.   :..|:|..:......|.:.|.....||           :|:.:|..
Mouse   608 SLKVYQVEDVCEEEMP---EESDECARMDRTPPPPTLSPAAVTVGRGEDLTSEHPLLEQVELPAV 669

  Fly  1030 YQKSAFIWDDYISEVGGMAASKELFTPRQPMEYQE---RMKLEVVDQRNPCLIRPATVVTR--KG 1089
            ...||.:...........|.:..|..|........   ......::.:.|..|....::|.  :|
Mouse   670 ASVSASVIKSPSDPTHASAPAPPLLIPAASTRSSSTSLASSTPSLENKPPQAIVKPQILTHVIEG 734

  Fly  1090 YRVQLHLDCWPTEYYFWLEDDSPDLHPI-------GWC-------------------------EA 1122
            :.:|..|:.:|......|.:......|:       ..|                         |.
Mouse   735 FVIQEGLEPFPVSRSSLLIEQPVKKRPLLDNQVVNSVCVQPELQNNTKHADNSSDTEIEDMMAEE 799

  Fly  1123 TSHELETPPGYLQPKSVMPCDVEGCRGFGN-------------AKRFNLNVHALRECC-PYAPEN 1173
            |..|:::        .::.|:..|..|:.|             |||:|::      |. .:|...
Mouse   800 TLEEMDS--------ELLKCEFCGKMGYPNEFLRSKRFCTMSCAKRYNVS------CSKKFALSR 850

  Fly  1174 WRQWRSKTVKPPRVAPENIRRGWAKKTKRACSEAKQAIKED--SQQEIVYPKVAEVVQAKRKTSP 1236
            |.:           .|:|...|   ...|..|..:.|.:|.  .|..|.||...|.|.:.....|
Mouse   851 WNR-----------KPDNQSLG---HRGRRPSGPEGAAREHILRQLPITYPSAEEDVASHEDPVP 901

  Fly  1237 CEEKVVKKQKQMQKEEDAEQVPDERSLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPLH 1301
             .....:.::|.::|.:.|              ::|...:.:|.      ||.. |...:|.|..
Mouse   902 -SAMTTRLRRQSERERERE--------------LRDVRIRKMPE------NSDL-LPVAQTEPSI 944

  Fly  1302 WTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLR 1364
            ||..||..:|.......|:|.....|:|||:|||:|....|.:.:.:|:|||:|:.:.|.:|:
Mouse   945 WTVDDVWAFIHSLPGCQDVADEFRAQEIDGQALLLLKEDHLMSAMNMKLGPALKICARINSLK 1007

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 14/104 (13%)
MBT 929..1028 CDD:214723 24/110 (22%)
MBT 1038..1130 CDD:214723 16/129 (12%)
SAM_PNT 1279..1366 CDD:280377 29/87 (33%)
Phc3XP_006535530.1 SAM_Ph1,2,3 940..1008 CDD:188976 25/69 (36%)
SAM 942..1009 CDD:197735 24/67 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.