DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and L3mbtl1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_011237842.1 Gene:L3mbtl1 MGIID:2676663 Length:848 Species:Mus musculus

Alignment Length:750 Identity:238/750 (32%)
Similarity:330/750 (44%) Gaps:147/750 (20%)


  Fly   598 PQTPPKSSSSSSSGSHASEMSPPPKLAD-PKPSSPPAKNAKK----ANDHDANPSPSSKTNDFKK 657
            ||.|   :::....::|:.:..|....| |.|..|....|.:    :....|...|...|.....
Mouse    35 PQLP---TTAFIIPTNAATLGLPSTALDVPYPREPVHVGALERVAGSEPVTATILPQLSTGTGTN 96

  Fly   658 SMMQNLNMLKWRGQQPANLQNSTVRFELNEF---NFLQINERCQPRQ---GPAAYFERPLYDRPG 716
            |   .:.:|.|.|.. |.|..|.:||.:||:   |.:.:.....|.|   |..|           
Mouse    97 S---TVRLLDWTGVS-APLPGSGMRFRINEYAPLNMIGVERPRSPEQRHEGGMA----------- 146

  Fly   717 RRPSACVHPLLY------------------LCQRCNFHGPAADFLAPHFCSVGCVRRSQKRRLPQ 763
            ||.:...||.::                  .||.|   ||..        |.|....|...|..|
Mouse   147 RRDAGIQHPDVHQDRQDITSLEPPVDASSCKCQAC---GPQQ--------SSGLDVGSSGDRCSQ 200

  Fly   764 STQKESKISRTQLEQTAGT-APDL--PQKRQTNYKPHKSLSAIQEQLQQRQ---KDKPRKP---- 818
            ..||.|.|    :|.:..| |.:|  |.|:: .:|.::|.|...|....:|   ||..|:|    
Mouse   201 PFQKRSVI----VENSGCTIASELLKPMKKR-KHKEYQSPSEESEPEAVKQGEGKDAEREPTPST 260

  Fly   819 -------------------FRWSEYLKSKGKDVAAPIHLFLNPFPI--SPNCFEIGMKLEAIDPE 862
                               :.|..||:.: |.|.||:.||.:...:  :.|.|::|||||.|||:
Mouse   261 PENEEWSRSQLVSSEKKDGWSWESYLEEQ-KAVTAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQ 324

  Fly   863 NCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFS 927
            :.|::.:.::.||.||||:|.|||||..:||||||:|.||.|.||.::|...||.||.|..|.||
Mouse   325 HPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQLPKGYKEEEFS 389

  Fly   928 WSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRV 992
            ||:||..|..:|||:.||   ..|.......||.|||.|||.|..:...:|||:|||::|.|..|
Mouse   390 WSQYLRSTKAQAAPKHLF---VSQSHSTPPVGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLV 451

  Fly   993 HFDGWDDCYDLWVHITSPYIHPCGWHEGRQQLIVPP-DY-QKSAFIWDDYISEVGGMAASKELFT 1055
            |||.|.|.||.|...:||||||.||.:.:.:.:.|| || ...:|.|:.|:.|.|..|.....|.
Mouse   452 HFDDWGDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDSFCWEKYLEETGTSAVPNWAFK 516

  Fly  1056 PRQPMEYQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWC 1120
            .|.|..:...||||.||:|||.|||.|:|...:.:|::||.|.|...|.||::.|.||:||.|||
Mouse   517 VRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKLHFDGWSHNYDFWIDADHPDIHPAGWC 581

  Fly  1121 EATSHELETPPGYLQPK---SVMP-------------------------CDVEGCRGFGNAKRFN 1157
            ..|.|.||.|   |:|:   ||.|                         |...||.|.|:... .
Mouse   582 SKTGHPLEPP---LRPRESSSVSPGGCPPLSHRSPPHTKTSKYNFHHRKCPTPGCDGSGHVTG-K 642

  Fly  1158 LNVHALRECCPYAPENWRQWRSKTVKPPRVA----PENI----------RRGWAKKTKRACSEAK 1208
            ...|.....||.|.:|..:.:::.......|    |.|:          |.|...|.::...|..
Mouse   643 FTAHHCLSGCPLAEKNQSRLKAELSDSETAARKKNPSNLSPRKKPRHQGRIGRPPKYRKIPEEDL 707

  Fly  1209 QAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVK 1243
            ||:......:.::..... ..|.|..|.|.|:..|
Mouse   708 QALPPSVVHQSLFMSTLP-THADRPLSVCWEQHCK 741

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 46/98 (47%)
MBT 929..1028 CDD:214723 45/99 (45%)
MBT 1038..1130 CDD:214723 41/92 (45%)
SAM_PNT 1279..1366 CDD:280377
L3mbtl1XP_011237842.1 MBT 283..380 CDD:214723 46/98 (47%)
MBT 391..487 CDD:214723 45/99 (45%)
MBT 499..591 CDD:214723 41/92 (45%)
zf-C2HC 627..653 CDD:279824 7/27 (26%)
SAM_superfamily 754..>787 CDD:301707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87057842
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T616443
orthoMCL 1 0.900 OOG5_130415
Panther 1 1.100 O PTHR12247
Phylome 1 0.910 0.771 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5341
TreeFam 1 0.960
87.730

Return to query results.
Submit another query.