DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and L3mbtl3

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001346183.1 Gene:L3mbtl3 MGIID:2143628 Length:883 Species:Mus musculus

Alignment Length:878 Identity:255/879 (29%)
Similarity:381/879 (43%) Gaps:194/879 (22%)


  Fly   664 NMLKWRGQQPANLQNSTVRFELNEFNFLQI------NERCQPRQGPAAYFERPLYDRPGRRPSA- 721
            :::.|: .....|..|.::|.:|||..|::      .|..:.......:......|.|...||: 
Mouse    17 SVMDWK-DGVGTLPGSDLKFRVNEFGALEVITDESEMESVKKATATTTWMVPTAQDAPTSPPSSR 80

  Fly   722 CVHPLLY-------------------------------LCQRCNFHGPAADFLA-PHFCSVGCVR 754
            .|.|..|                               .|:.|..:|...:.|: ..:||..|.|
Mouse    81 PVFPPAYWTSPPGCPTVFSEKTGVPFRLKEQSKADGLQFCENCCQYGNGDECLSGGKYCSQNCAR 145

  Fly   755 RSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSA----------------- 802
            .::        .|:.|..|...|......|...:|:    ||..||.|                 
Mouse   146 HAK--------DKDQKDERDGGEDNDEEDPKCSRKK----KPKLSLKADSKDDGEERDDEMENKQ 198

  Fly   803 -------IQEQLQQRQKD----------KPRKPFRWSEYLKSKGKDVAAPIHLFL--NPFPISPN 848
                   .|...::|:.|          |.:|.:.|:.||:.: |.||.|..||.  ..||.:.|
Mouse   199 DGRILRGSQRARRKRRGDSAVLKQGLPPKGKKTWCWASYLEEE-KAVAVPTKLFKEHQSFPYNKN 262

  Fly   849 CFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETAR 913
            .|::|||||.:||::.:::||.::.||.|||:||.|||||..||||||||:.||.|.|||::|..
Mouse   263 GFKVGMKLEGVDPDHQAMYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGH 327

  Fly   914 VLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKIC 978
            .|:.||.|..|.|:|..||.....:|||::||.:.|:..   :.:||.|||.|||.|......||
Mouse   328 KLRPPKGYKEEEFNWQSYLKTCKAQAAPKSLFENQNITV---IPSGFRVGMKLEAADKKSPSVIC 389

  Fly   979 VATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGW-HEGRQQLIVPPDYQK-SAFIWDDYI 1041
            ||||||::|.|..||||.||:.||.|....||:|||.|| .|.|:.||.||.|.. ..|.||.|:
Mouse   390 VATVTDMVDNRFLVHFDNWDESYDYWCESNSPHIHPVGWCKEHRRTLITPPGYSHVKHFSWDKYL 454

  Fly  1042 SEVGGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFW 1106
            .|...:.|....|..:.|..:|::||||.||:|||..||.|||.....:|:::|.|.|.:.|.:|
Mouse   455 EETNSLPAPARAFKVKPPHGFQKKMKLEAVDKRNPLFIRVATVADTDDHRIKVHFDGWSSCYDYW 519

  Fly  1107 LEDDSPDLHPIGWCEATSHELETP--PGYL-QPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCP 1168
            ::.||||:||:|||..|.|.|:.|  |..| :|.....|...||||.|:.|:...........||
Mouse   520 IDADSPDIHPVGWCSKTGHPLQAPLSPAELMEPSETGGCPTLGCRGVGHFKKSRYLGTQSGANCP 584

  Fly  1169 YAPENWRQWR------SKTVKPPRV----------------APE-------NIRRGWAKKTK--- 1201
            |:..|..:.|      |....||..                :||       |.:....||.:   
Mouse   585 YSEINLSKERIFPDRLSGDTSPPTTPSFPRSKRMDTRESSSSPETREKHANNFKEDSEKKKENEV 649

  Fly  1202 RACSEAKQAIKEDS--------------------------------------------------- 1215
            :..:|||...:|.:                                                   
Mouse   650 KTSAEAKVVREEPTPSVQQSQPPQQVQQVQHAQPPQQAQKAPQAQQAQQAQQAQQAPQAPQTPQP 714

  Fly  1216 ------QQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQMQKEEDAEQVPDERSLAIARSFV-KDY 1273
                  ||....|:..:..|.::...|.:...|::.:|:|:.:..:|....:..|..||.| ..:
Mouse   715 QQAPQVQQAQQAPQAQQAQQPQQAQQPQQAPPVQQPQQVQQAQPTQQQAQTQQQAQRRSAVFLSF 779

  Fly  1274 GPQFLPNYRL-WQLNSAFKLDDVRTNPL----HWTSWDVCEYIERALDSTDIAKVIFEQDIDGRA 1333
            .|. :|...| |:..|.. |..|...|.    .|::.:|.|:|:......:..||..::.|||.|
Mouse   780 KPP-IPCLPLRWEQQSKL-LPTVAGIPASRVSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEA 842

  Fly  1334 LLMLGRKELDTYLKLKVGPAVKLYSLILNLRIA 1366
            .|::.:.::...:.:|:|||:|:::.||..:.|
Mouse   843 FLLMTQTDIVKIMSIKLGPALKIFNSILMFKAA 875

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 49/98 (50%)
MBT 929..1028 CDD:214723 48/100 (48%)
MBT 1038..1130 CDD:214723 39/92 (42%)
SAM_PNT 1279..1366 CDD:280377 25/92 (27%)
L3mbtl3NP_001346183.1 MBT 1 232..332 50/101 (50%)
MBT 236..332 CDD:214723 49/97 (51%)
MBT 2 340..439 49/102 (48%)
MBT 343..439 CDD:214723 47/99 (47%)
MBT 3 448..543 41/95 (43%)
MBT 451..543 CDD:214723 39/92 (42%)
zf-C2HC 557..586 CDD:307601 10/29 (34%)
SAM_Scm-like-3MBT3,4 808..873 CDD:188981 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87253122
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H18226
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002641
OrthoInspector 1 1.000 T616443
orthoMCL 1 0.900 OOG5_130415
Panther 1 1.100 O PTHR12247
Phylome 1 0.910 0.677 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5341
TreeFam 1 0.960
109.730

Return to query results.
Submit another query.