DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and SCMH1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_006710525.1 Gene:SCMH1 HGNCID:19003 Length:670 Species:Homo sapiens

Alignment Length:721 Identity:162/722 (22%)
Similarity:248/722 (34%) Gaps:227/722 (31%)


  Fly   792 TNYKPHK--SLSAIQEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEIGM 854
            ::.:.||  .||....|.|:.........|.|.:||| :...|.||:|.|...:....|.|:|.|
Human     9 SDVRKHKYGHLSESASQYQEAADILDLGHFTWDKYLK-ETCSVPAPVHCFKQSYTPPSNEFKISM 72

  Fly   855 KLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETARVLQAPK 919
            ||||.||.|.:..|:.::|.:.|.||:|..||..:..|||...||.:|.|.|.|::...:||.|.
Human    73 KLEAQDPRNTTSTCIATVVGLTGARLRLRLDGSDNKNDFWRLVDSAEIQPIGNCEKNGGMLQPPL 137

  Fly   920 DYNSERFSWSRYLVKT--GGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATV 982
            .:.....||..:|:||  |.:.||..:|   :.:......|.|.:||.|||.|..:...||.||:
Human   138 GFRLNASSWPMFLLKTLNGAEMAPIRIF---HKEPPSPSHNFFKMGMKLEAVDRKNPHFICPATI 199

  Fly   983 TDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGWHEGRQQLIVPPDYQ----KSAFIWDDYISE 1043
            .::....:.|.||||...:|.|....|..|.|.||.......:.||..:    |:.:...|..:|
Human   200 GEVRGSEVLVTFDGWRGAFDYWCRFDSRDIFPVGWCSLTGDNLQPPGTKVVIPKNPYPASDVNTE 264

  Fly  1044 VGGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIR---PATVVTRKGYRVQLHLDCWPTEYYF 1105
            ...:.:|.:.....||.:          ..|.|...|   |.|:::                   
Human   265 KPSIHSSTKTVLEHQPGQ----------RGRKPGKKRGRTPKTLIS------------------- 300

  Fly  1106 WLEDDSPDLHPIGWCEATSHELETP------PG-------YLQP-------------KSVMPCDV 1144
                     |||.....|:..|:.|      ||       .|.|             .|.:|.|.
Human   301 ---------HPISAPSKTAEPLKFPKKRGPKPGSKRKPRTLLNPPPASPTTSTPEPDTSTVPQDA 356

  Fly  1145 -------------------EGCRG--------------FGNAKRFNLNVHALREC--CPYAPENW 1174
                               .|..|              ||.|:...:...|::.|  |.|     
Human   357 ATIPSSAMQAPTVCIYLNKNGSTGPHLDKKKVQQLPDHFGPARASVVLQQAVQACIDCAY----- 416

  Fly  1175 RQWRSKTVKPPRVAPENIRRGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAKR------- 1232
               ..|||.      ..:::|..       .|...|:.:..|..:..|.|..:....|       
Human   417 ---HQKTVF------SFLKQGHG-------GEVISAVFDREQHTLNLPAVNSITYVLRFLEKLCH 465

  Fly  1233 ------------------------------KTSPCEEKVVKKQ--KQMQKEEDAEQ--------- 1256
                                          :..|.|..|:...  :.::...|:..         
Human   466 NLRSDNLFGNQPFTQTHLSLTAIEYSHSHDRYLPGETFVLGNSLARSLEPHSDSMDSASNPTNLV 530

  Fly  1257 --------------VPDERSLAI----ARSFVKDYGPQFLPNYR-----LWQLN----------- 1287
                          :|...:.|:    :|..:|.      .|.|     .|:||           
Human   531 STSQRHRPLLSSCGLPPSTASAVRRLCSRGVLKG------SNERRDMESFWKLNRSPGSDRYLES 589

  Fly  1288 -SAFKLDDVRTNPLHWTSWDVCEYIERALDSTDIAKVIF-EQDIDGRALLMLGRKELDTYLKLKV 1350
             .|.:|..  .:|..||..||.:::..|.........:| :.:|||:|||:|....:..|:.||:
Human   590 RDASRLSG--RDPSSWTVEDVMQFVREADPQLGPHADLFRKHEIDGKALLLLRSDMMMKYMGLKL 652

  Fly  1351 GPAVKL 1356
            |||:||
Human   653 GPALKL 658

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 38/96 (40%)
MBT 929..1028 CDD:214723 32/101 (32%)
MBT 1038..1130 CDD:214723 15/95 (16%)
SAM_PNT 1279..1366 CDD:280377 29/97 (30%)
SCMH1XP_006710525.1 MBT 41..136 CDD:214723 38/96 (40%)
MBT 147..245 CDD:214723 32/101 (32%)
DUF3588 368..476 CDD:288954 19/129 (15%)
SAM_Scm 597..667 CDD:188977 22/65 (34%)
SAM 600..667 CDD:197735 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86874938
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.