DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and L3mbtl2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001276640.1 Gene:L3mbtl2 MGIID:2443584 Length:739 Species:Mus musculus

Alignment Length:773 Identity:160/774 (21%)
Similarity:276/774 (36%) Gaps:245/774 (32%)


  Fly   621 PKLADPKPSSPPAKNAKKANDHDA----------NPSPSSKTNDFKKSMMQNLNMLKWRGQQPAN 675
            |:..:..|||.|.:. ::.:|.|.          |.|..|:::.:.:...:..|..:..|:.|  
Mouse     4 PRGTEEAPSSEPMEE-EEEDDLDLFGGYDSFRSYNSSAGSESSSYLEESSEAENEDREAGELP-- 65

  Fly   676 LQNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSACVHPLLYLCQRCNFHGPAA 740
                |....|    |...|.|.              .|..|..|:        :|:.|...|...
Mouse    66 ----TSPLHL----FSSANNRS--------------LDGSGSEPA--------VCEMCGIVGTRE 100

  Fly   741 DFLA--PHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKS--LS 801
            .|.:  ..||||.|     .|....:::|.|.::|.|     |..|  .:|.:..:|...|  :.
Mouse   101 AFFSKTKRFCSVSC-----SRSYSSNSKKASILARLQ-----GKPP--TKKAKVLHKAAWSAKIG 153

  Fly   802 AIQEQLQQRQ--------KDKPRKPFRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEI--GMKL 856
            |........|        :|.....|.|.::||..... |||:..|.: .|:.....::  |||:
Mouse   154 AFLHAQGTGQLADGTPTGQDALVLGFDWGKFLKDHSYK-AAPVSCFKH-VPLYDQWEDVMKGMKV 216

  Fly   857 EAIDPE---NCSLFCVCSIVEVRGYRLKLSFDGY--SSMYDFWVNADSQDIFPPGWCDETARVLQ 916
            |.::.:   ...::.:.::::..|||:.|.::|:  .:.:|||.|..:.|:.|.|||...:::|.
Mouse   217 EVLNSDAVLPSRVYWIATVIQAAGYRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKILV 281

  Fly   917 APKDYNSERFSWSRYLVK--TGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICV 979
            .|:..:::...|..||:|  .|.:..|...  |:.|.:.|  :..|..||.||..|.....:..:
Mouse   282 PPRTIHAKFTDWKSYLMKRLVGSRTLPADF--HIKMVESM--KYPFRQGMRLEVVDKTQVSRTRM 342

  Fly   980 ATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGW--------------------------- 1017
            |.|..::..|:|:.::..|...|.|.|:.||.|||.||                           
Mouse   343 AVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSDRRCDMSHHPTFRKIY 407

  Fly  1018 ---------------------HEGRQ--------------------------------------- 1022
                                 .||.:                                       
Mouse   408 CDAVPYLFKKVRAVYTEGGWFEEGMKLEAIDPLNLGSICVATICKVLLDGYLMICVDGGPSTDGS 472

  Fly  1023 -----------------------QLIVPPDYQKSAFIWDDYISEVGGMAASKELFTPRQPME-YQ 1063
                                   :|..|..|:...|.|:.|:.:....||...||....|.. ::
Mouse   473 DWFCYHASSHAIFPATFCQKNDIELTPPKGYETQPFAWETYLEKTKSKAAPARLFNMDCPNHGFK 537

  Fly  1064 ERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELE 1128
            ..||||.||...|.||..|||.......:.:|.|.|..||..|::.:|||::|:||||.|.::|:
Mouse   538 VGMKLEAVDLMEPRLICVATVKRVVHRLLSIHFDGWDNEYDQWVDCESPDIYPVGWCELTGYQLQ 602

  Fly  1129 TPPGYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPYAPENWRQWRSKTVKPPRVAPENIR 1193
             ||...:|.:                                |:..:....|.           :
Mouse   603 -PPVSAEPNT--------------------------------PQKGKDTTKKK-----------K 623

  Fly  1194 RGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKV----VKKQKQ 1247
            :.:.||.||..|...:.:::.|::    |.:.:.::|...:.|..:.:    ||::.|
Mouse   624 KQFGKKRKRIPSAKTRPLRQGSKK----PLLEDNLEALGVSEPVPDDIIAVCVKEEHQ 677

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 26/103 (25%)
MBT 929..1028 CDD:214723 33/211 (16%)
MBT 1038..1130 CDD:214723 34/93 (37%)
SAM_PNT 1279..1366 CDD:280377
L3mbtl2NP_001276640.1 MBT 183..283 CDD:214723 26/102 (25%)
MBT 294..390 CDD:214723 29/100 (29%)
MBT 433..504 CDD:280910 3/71 (4%)
MBT 511..604 CDD:214723 35/94 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.