DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and PHC2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_932157.1 Gene:PHC2 HGNCID:3183 Length:858 Species:Homo sapiens

Alignment Length:990 Identity:187/991 (19%)
Similarity:318/991 (32%) Gaps:309/991 (31%)


  Fly     2 LPLSMASAEAKQLQRNISLSMSPANGGVISPSTANCNGVASASGGNPNPN----SLLTLAPRKEE 62
            ||:...|:.|        .:.|..:|   :.|::.||.  |:|||:..|.    |:.:..|.::.
Human     5 LPVPHTSSSA--------CATSSTSG---ASSSSGCNN--SSSGGSGRPTGPQISVYSGIPDRQT 56

  Fly    63 LRFLPLAPMGGNKTCNITISNV---QPMKSKLKSVNIVPNSIKSAGAGATVGSADAPLFQLVPSP 124
            ::.:..|......|....:..:   |.....|::..:....:.||              ||    
Human    57 VQVIQQALHRQPSTAAQYLQQMYAAQQQHLMLQTAALQQQHLSSA--------------QL---- 103

  Fly   125 SNPSQPLVAI----LAPNRKTTLLGGGASNGQPVVIRSGTPLHKNSLTVETS-------NKPIQP 178
                |.|.|:    |..||:      |:::|..|..::  |...:|:.:..|       |: .|.
Human   104 ----QSLAAVQQASLVSNRQ------GSTSGSNVSAQA--PAQSSSINLAASPAAAQLLNR-AQS 155

  Fly   179 GGSAAAAAVG------GGTGGAPLTL--------VGKTVVPPKIQAATPVQIPSTGPGAQVSLLA 229
            ..||||:.:.      |.|....||.        ....:..|....|| || |..|.|       
Human   156 VNSAAASGIAQQAVLLGNTSSPALTASQAQMYLRAQMLIFTPTATVAT-VQ-PELGTG------- 211

  Fly   230 NPLKPRAPLILSKVAVDKLRLKFSQVKSNPNALVLGKANH---VKKLLTSPNPSGEDKTRS-TQK 290
            :|.:|..|     ..|..|.|:..|   .|.|...|....   :..|...|.|.|.....: .|.
Human   212 SPARPPTP-----AQVQNLTLRTQQ---TPAAAASGPTPTQPVLPSLALKPTPGGSQPLPTPAQS 268

  Fly   291 NNKQNTSASQLKPVVAPKTAMPIA-----TEVPTADNNKMSLIKSKPVAIKAVPLPSQEAPIVPA 350
            .|....|.:..||.:|.....|..     :.||.:...:..|.::.| |:.|.||      |.||
Human   269 RNTAQASPAGAKPGIADSVMEPHKKGDGNSSVPGSMEGRAGLSRTVP-AVAAHPL------IAPA 326

  Fly   351 VAPVVTSPEKVDVKPTAK---PSIKTAPKPTPKPLEMSVNGPAKEKKAP---AKEQKQKTMDKPP 409
            .|.:  .|.::..:|::|   |......:|.|:..:     |..::..|   |:...|.....|.
Human   327 YAQL--QPHQLLPQPSSKHLQPQFVIQQQPQPQQQQ-----PPPQQSRPVLQAEPHPQLASVSPS 384

  Fly   410 VVKE---------IAQHTPCGPKELPKLKRSKSFVSN--HPASPVANNERRHSVAIMAKEVDVIE 463
            |..:         :...||..|.:.|.....|...|.  ||.:|....:..|...:........:
Human   385 VALQPSSEAHAMPLGPVTPALPLQCPTANLHKPGGSQQCHPPTPDTGPQNGHPEGVPHTPQRRFQ 449

  Fly   464 QPSAAIETITIEDDDESEEEQQKPEIKK--TPKQNQKPEKQEAPK-KKQIPMPILPAGITISTTS 525
            ..||.|    ::....|..:|..|:..|  .|.:...||.:..|. .:|..:..:|.|:.:.|:.
Human   450 HTSAVI----LQLQPASPPQQCVPDDWKEVAPGEKSVPETRSGPSPHQQAIVTAMPGGLPVPTSP 510

  Fly   526 TAKKKAVRKNSSVTTISSSSSDSSSYSDVEVVPTKKTEKELSMLPGISIIKAESLPLSREDFERS 590
            ..:.....:...  .|..:.:|.||                   ||::.....|           
Human   511 NIQPSPAHETGQ--GIVHALTDLSS-------------------PGMTSGNGNS----------- 543

  Fly   591 LRCDEQVPQTPPKSSSSSSSGSHASEMSPPPKLADPKPSSPPAKNAKKANDHDANPSPSSKTNDF 655
                         :||.:.:.....|..||..:..|:..:...:..  .....|.|.|..:::  
Human   544 -------------ASSIAGTAPQNGENKPPQAIVKPQILTHVIEGF--VIQEGAEPFPVGRSS-- 591

  Fly   656 KKSMMQNLNMLKWRGQQPANL--QNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRR 718
              .::.||.....:|..|..|  |:.|...:                    :..|.| |.:..:.
Human   592 --LLVGNLKKKYAQGFLPEKLPQQDHTTTTD--------------------SEMEEP-YLQESKE 633

  Fly   719 PSACVHPLLYLCQRCNFHGPAADFL-----APHFCSVGCVR----------------RSQKRRLP 762
            ..|   ||...|:.|.    ..||.     :..|||:.|.:                ||:.::..
Human   634 EGA---PLKLKCELCG----RVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAG 691

  Fly   763 QSTQKESKISRTQL--------EQTAGTAP-------DLPQKRQ--------TNY-KPHKSLSAI 803
            .:|....:.|:..|        :|..||.|       .|...::        ::| :|...:||.
Human   692 AATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQEDSSRCSDNSSYEEPLSPISAS 756

  Fly   804 QEQLQQRQKDK--------------------PRKPFRWS-----EYLKSKGKDVAAPIHLFLNPF 843
            ....::||..:                    |.:|.:|:     |:::|                
Human   757 SSTSRRRQGQRDLELPDMHMRDLVGMGHHFLPSEPTKWNVEDVYEFIRS---------------- 805

  Fly   844 PISPNCFEIGMKLEA 858
              .|.|.||..:..|
Human   806 --LPGCQEIAEEFRA 818

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 7/43 (16%)
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
PHC2NP_932157.1 Intrinsically disordered. {ECO:0000250|UniProtKB:Q9QWH1} 1..76 18/84 (21%)
Interaction with BMI1. {ECO:0000250|UniProtKB:Q9QWH1} 33..53 6/20 (30%)
COG3416 53..>176 CDD:225950 28/154 (18%)
HD1 558..587 6/31 (19%)
PHC2_SAM_assoc 670..788 CDD:293222 16/118 (14%)
SAM_Ph1,2,3 789..857 CDD:188976 9/49 (18%)
SAM 791..858 CDD:197735 9/47 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.