DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and PHC1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_011518905.1 Gene:PHC1 HGNCID:3182 Length:1021 Species:Homo sapiens

Alignment Length:968 Identity:200/969 (21%)
Similarity:309/969 (32%) Gaps:335/969 (35%)


  Fly     7 ASAEAKQLQRNISLSMSPANGGVISPSTANCN--GVASASGGNPNPNSLLTLAPRKEELRFLPLA 69
            |||:..|:|.:...::.|....|.|.|.|:..  .||.||.|..|.:              |.|:
Human   232 ASAQGPQMQGSTQKAIPPGASPVSSLSQASSQALAVAQASSGATNQS--------------LNLS 282

  Fly    70 PMGGNKTCNITISNVQPMKSKLKSVNIVPNSIKSAGAGATVGSADAPLFQLVPSPSNPSQPLVAI 134
            ..||.                  |.|.:|.|:...|.|...|.    |.||   ||:.       
Human   283 QAGGG------------------SGNSIPGSMGPGGGGQAHGG----LGQL---PSSG------- 315

  Fly   135 LAPNRKTTLLGGGASNGQPVVIRSGT----PLHKNSLTVETSNKPIQPGGSAAAAAVGGGTG--- 192
                     :|||:..      |.||    ||........:.....:...:||..|...|:|   
Human   316 ---------MGGGSCP------RKGTGVVQPLPAAQTVTVSQGSQTEAESAAAKKAEADGSGQQN 365

  Fly   193 -GAPLTLVGKTVVPPK----IQAATPVQIPSTGPGAQVSLLANP----LKPRAPLILSKVAVDKL 248
             |..||   :|..|..    |.:||..||...      ||:...    |:.:..:|..::|:.. 
Human   366 VGMNLT---RTATPAPSQTLISSATYTQIQPH------SLIQQQQQIHLQQKQVVIQQQIAIHH- 420

  Fly   249 RLKFSQVKSNPNALVLGKANHVKKLLTSPNPSGEDKTRSTQKNNKQNTSASQLKPVVAPKTAMPI 313
            :.:|...:|.    :|..|.|::              .:.|:..:|.....|.:|.....|| |.
Human   421 QQQFQHRQSQ----LLHTATHLQ--------------LAQQQQQQQQQQQQQQQPQATTLTA-PQ 466

  Fly   314 ATEVPTADNNKMSLIKSKPVAIKAVPLPSQEAPIVPAVAPVVTSPEKVDVKPTAKPSIKTAPKPT 378
            ..:||...              :..|..||:......|.|::.|      .|.:.|. ..|||| 
Human   467 PPQVPPTQ--------------QVPPSQSQQQAQTLVVQPMLQS------SPLSLPP-DAAPKP- 509

  Fly   379 PKPLEMSVNGPAKEKKAPAKEQKQKTMDKPPVVKEIAQHTPCGPKELPKLKRSKSFVSNHPAS-- 441
            |.|::                      .||||          .|.:.|:|..:|...:..|..  
Human   510 PIPIQ----------------------SKPPV----------APIKPPQLGAAKMSAAQQPPPHI 542

  Fly   442 PVANNERRHSVAIMAKEVDVIEQPSAAIETI-----TIEDDDESEEEQQKPEIKKTPKQNQKP-E 500
            ||.....|......|:.:. :.|.:||:.|.     |::..        :..:..:|..:|.| .
Human   543 PVQVVGTRQPGTAQAQALG-LAQLAAAVPTSRGMPGTVQSG--------QAHLASSPPSSQAPGA 598

  Fly   501 KQEAPKKKQIPMPILPAGITIS----TTSTAKKKAVRKNSSVTTISSSSSDSSSYSDVEVVPTKK 561
            .||.|       |.|..|:|::    |....|..|...:..|..:.::....|.:          
Human   599 LQECP-------PTLAPGMTLAPVQGTAHVVKGGATTSSPVVAQVPAAFYMQSVH---------- 646

  Fly   562 TEKELSMLPGISIIKAESLPLSREDFERSLRCD------------EQVPQTPPKSSSSSSSGSHA 614
                   |||    |.::|.:.|:......|.|            ..|.::|......||.|..|
Human   647 -------LPG----KPQTLAVKRKADSEEERDDVSTLGSMLPAKASPVAESPKVMDEKSSLGEKA 700

  Fly   615 SEM------SPPPKLA--DPKPSSPPAKNAKKAND-HDANP-----SPSSKTNDFKKSMMQNLNM 665
            ..:      :|..:|.  .|.||.||...|..:.. .|:.|     .|...|:..:..::|    
Human   701 ESVANVNANTPSSELVALTPAPSVPPPTLAMVSRQMGDSKPPQAIVKPQILTHIIEGFVIQ---- 761

  Fly   666 LKWRGQQPANLQNSTVRFELNEFNFLQINERCQPRQGPAAYFER----PL-YDRPGRRPSACVHP 725
               .|.:|         |.:.....|:.:|:......|....|.    || .|.|........: 
Human   762 ---EGAEP---------FPVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKAN- 813

  Fly   726 LLYLCQRCNFHGPAADFL-APHFCSVGCVRR-----SQKRRLPQSTQKESKISRTQLEQTAGTAP 784
             |..|:.|..:.||..|. :..|||:.|.:|     |.:.||.:...||.               
Human   814 -LLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEF--------------- 862

  Fly   785 DLPQKRQTNYK------PHKSLS-----AIQEQLQQRQKDKPRKPFRWSEYLKSKGKD------V 832
                 ::.||.      |.:|.|     .||.:..:.|:|            .|:|.|      .
Human   863 -----QEANYARVRRRGPRRSSSDIARAKIQGKCHRGQED------------SSRGSDNSSYDEA 910

  Fly   833 AAPIHLFLNPFPIS------------PNCFEIGMKLEAIDP----ENCSLFCVCSIVE 874
            .:|    .:|.|:|            ||......:|..|:|    .|.|.:.|..:.|
Human   911 LSP----TSPGPLSVRAGHGERDLGNPNTAPPTPELHGINPVFLSSNPSRWSVEEVYE 964

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 16/76 (21%)
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
PHC1XP_011518905.1 zf-FCS 809..844 CDD:283998 11/37 (30%)
PHC2_SAM_assoc 845..951 CDD:293222 26/142 (18%)
SAM_Ph1,2,3 952..1020 CDD:188976 4/14 (29%)
SAM 954..1021 CDD:197735 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86472617
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.