DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and mbtr-1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001122542.1 Gene:mbtr-1 WormBaseID:WBGene00021661 Length:564 Species:Caenorhabditis elegans

Alignment Length:401 Identity:86/402 (21%)
Similarity:143/402 (36%) Gaps:98/402 (24%)


  Fly   781 GTAPDLPQKRQTNYKPHKSLSAIQEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPIHLFLNPFPI 845
            |:.|..|..|.|    .:.|...|.:|.:.:..:| |.|....:|..:                 
 Worm   196 GSTPAPPVPRPT----EEILDEFQAELHENRISEP-KIFDQLRHLAHR----------------- 238

  Fly   846 SPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYD-----------------F 893
             |:.|.:..::|.::....:...|..|:.:.|.||.:.........|                 |
 Worm   239 -PSRFRLNQRVELLNYLEPTEIRVARILRILGRRLMVMVTAQDYPEDLPSVEAKDRQVQHENVEF 302

  Fly   894 WVNADSQDIFP--------------PGWCDETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRAL 944
            ||:..|..:||              .|:.:.:.|:.:....|:.:..::.:..   .||  |...
 Worm   303 WVDESSFFLFPVGFAMINGLRTKATEGYLEHSRRIAEGSGSYHKDDVTFEQLF---AGK--PDIS 362

  Fly   945 FGHLNMQQQMDVRNGFAVGMHLEAED-LNDTGK-ICVATVTDIL----------DERIRVHFDGW 997
            ...||:         ..||...|..| |:|..: .||||:..|.          ||.     :..
 Worm   363 AEKLNL---------LKVGQKFELLDPLSDLRQSFCVATIRKICKTPGFLIISPDET-----ESD 413

  Fly   998 DDCYDLWVHITSPYIHPCGWHEGRQQLIVPPD----YQKSAFIWDDYISEVGGMAASKELFTPRQ 1058
            |:.:.  :||.:.::||.|:.|   :..:..|    .:...|.|:.|:.|........|:..|..
 Worm   414 DESFP--IHIDNHFMHPVGYAE---KFGIKLDRLAGTEPGKFKWEGYLKEKQAEKIPDEMLRPLP 473

  Fly  1059 PMEYQERMK----LEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGW 1119
            ..|.:...:    ||.|.|.....|.||:|....|..|.:....|.:|:....:.||.||.|.||
 Worm   474 SKERRHMFEFGRVLEAVGQNETYWISPASVEEVHGRTVLIEFQGWDSEFSELYDMDSHDLLPAGW 538

  Fly  1120 CEATSHELETP 1130
            ||..:.:|..|
 Worm   539 CEFFNFKLRHP 549

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 18/127 (14%)
MBT 929..1028 CDD:214723 25/111 (23%)
MBT 1038..1130 CDD:214723 27/96 (28%)
SAM_PNT 1279..1366 CDD:280377
mbtr-1NP_001122542.1 MBT 75..164 CDD:302657
MBT 217..326 CDD:214723 20/128 (16%)
MBT 374..439 CDD:280910 18/75 (24%)
MBT 453..540 CDD:214723 25/87 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.