DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and phc2a

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_694490.2 Gene:phc2a ZFINID:ZDB-GENE-020312-1 Length:827 Species:Danio rerio

Alignment Length:688 Identity:143/689 (21%)
Similarity:236/689 (34%) Gaps:214/689 (31%)


  Fly    13 QLQRNISLSMSPANGGVISPSTANCNGVASASGGNPNPNSLLTLAPRKEELRFLPLAPMGGNKTC 77
            |:.|::..:: |.:..:|...||:...:...:   |.| |:.|| |...:::.|.|....|..|.
Zfish   195 QVARSLGRAV-PLSSQLIFTPTASVTAIQPEA---PAP-SINTL-PTSGQVQNLALRSQQGALTS 253

  Fly    78 NITISNVQPMKSKLKSVNIVPNSI-KSAGAGATVGSADAPLFQLVPSP------SNPSQPLVAIL 135
            .::.|.:|.:..|....::...|: :..|.||.            |||      ::|::......
Zfish   254 TLSQSQLQSLSVKQSVASVTGQSVARLKGLGAE------------PSPQGTAAKASPAETSSETT 306

  Fly   136 APNRKTTLLGGG------ASNGQPVVIRSGTPL--------HKNSLTVETSNKPIQPGGS--AAA 184
            |.|.||:.|...      :..|.|.:..:.|.:        ||....::...:.:|.|.:  ..|
Zfish   307 AKNDKTSDLTTSVCPSVTSVAGHPFISTAYTQIQTHQLLQQHKQQFVIQQQPQILQRGQAQLLEA 371

  Fly   185 AAVGGGTGGAPLTLVGKTVVPPKIQAATPVQIPSTGPGAQVSLLANPLKPRAPLILSKVAVDKLR 249
            ||:.           ..||....||:|.|.| |...|        .||.|:.|:...:..:    
Zfish   372 AAIH-----------PHTVQAVAIQSALPAQ-PQQCP--------IPLLPKVPVTCQQATI---- 412

  Fly   250 LKFSQVKSNPNALVLGKANHVKKLLTSP-----------NPSGEDKTRSTQKNNKQNTSASQLKP 303
              |.....:..||......|:.....:|           :|....:..::|....::|      |
Zfish   413 --FHSTTVSQQALAQNGQAHILTNTKAPPLQLTAVKCQIHPVQIQQGVASQNVPDKDT------P 469

  Fly   304 VVAPKTAMPIATEVPT----ADNNKMSLIKSK---PVAIKA-VPLPSQEAPIVPAV-------AP 353
            |:.....:.|..:.||    ..::|.|.:|..   .|.:|| |..|       ||:       ||
Zfish   470 VLLEPQLLSIPIQEPTRTELRQSDKESQVKENTQGSVNVKAGVGSP-------PAMTSGSGNNAP 527

  Fly   354 VVT--SPEKVDVKP----TAKPSIKT------------APKPTPKPLEMSVNGPAKEKKAPAKEQ 400
            .||  :|:..:.||    ..||.|.|            .|.|..:|..:..|...|:..|.:..|
Zfish   528 TVTGSAPQNGESKPPPQAVVKPQILTHVIEGFVIQEGAEPFPVERPSLLIENLKQKQHHAYSDLQ 592

  Fly   401 K------------QKTMDKPPVVKEIAQHTPCGPKELP-KLKRSKSFVSNHPASPVANNERRHSV 452
            |            |:..::|..|:....   ||..:.. ..||||.|.|...|       :|::|
Zfish   593 KHNADSEMEDLSLQELNNQPEPVRTCEF---CGNVDFAFNFKRSKRFCSTVCA-------KRYNV 647

  Fly   453 AIMAKEVDVIEQPSAAIETITIEDDDESEEEQQKPEIKKTPK-QNQKPEKQEAPKKKQIPMPILP 516
            . ..|.:.:....|:                   ||..|.|| .::.|:......:|:.|     
Zfish   648 G-CTKRMGLFPGKSS-------------------PEDTKKPKASDESPKNCSTETRKRNP----- 687

  Fly   517 AGITISTTSTAKKKAVRKNSSVTTISSSSSDSSSYSDVEVVPTKKTEKELSMLPGISIIKAESLP 581
               :|.||:.|...:...:......||..||.|||           |:.:|             |
Zfish   688 ---SIQTTTGASLLSPHPSHPSHGESSQCSDMSSY-----------EEPIS-------------P 725

  Fly   582 LSREDFERSLRCDEQVPQTPPKSSSSSSSGSHASEMSP 619
            ||...|...:..:|              |..|:.|::|
Zfish   726 LSNSSFGAPIEHEE--------------SFDHSRELTP 749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
phc2aNP_694490.2 Intrinsically disordered. {ECO:0000250|UniProtKB:Q9QWH1} 1..78
HD1 540..570 8/30 (27%)
PHC2_SAM_assoc 646..756 CDD:293222 33/171 (19%)
SAM_Ph1,2,3 758..826 CDD:188976
SAM 760..827 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.