| Sequence 1: | NP_733209.1 | Gene: | l(3)mbt / 43288 | FlyBaseID: | FBgn0002441 | Length: | 1477 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_694490.2 | Gene: | phc2a / 171465 | ZFINID: | ZDB-GENE-020312-1 | Length: | 827 | Species: | Danio rerio | 
| Alignment Length: | 688 | Identity: | 143/688 - (20%) | 
|---|---|---|---|
| Similarity: | 236/688 - (34%) | Gaps: | 214/688 - (31%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    13 QLQRNISLSMSPANGGVISPSTANCNGVASASGGNPNPNSLLTLAPRKEELRFLPLAPMGGNKTC 77 
  Fly    78 NITISNVQPMKSKLKSVNIVPNSI-KSAGAGATVGSADAPLFQLVPSP------SNPSQPLVAIL 135 
  Fly   136 APNRKTTLLGGG------ASNGQPVVIRSGTPL--------HKNSLTVETSNKPIQPGGS--AAA 184 
  Fly   185 AAVGGGTGGAPLTLVGKTVVPPKIQAATPVQIPSTGPGAQVSLLANPLKPRAPLILSKVAVDKLR 249 
  Fly   250 LKFSQVKSNPNALVLGKANHVKKLLTSP-----------NPSGEDKTRSTQKNNKQNTSASQLKP 303 
  Fly   304 VVAPKTAMPIATEVPT----ADNNKMSLIKSK---PVAIKA-VPLPSQEAPIVPAV-------AP 353 
  Fly   354 VVT--SPEKVDVKP----TAKPSIKT------------APKPTPKPLEMSVNGPAKEKKAPAKEQ 400 
  Fly   401 K------------QKTMDKPPVVKEIAQHTPCGPKELP-KLKRSKSFVSNHPASPVANNERRHSV 452 
  Fly   453 AIMAKEVDVIEQPSAAIETITIEDDDESEEEQQKPEIKKTPK-QNQKPEKQEAPKKKQIPMPILP 516 
  Fly   517 AGITISTTSTAKKKAVRKNSSVTTISSSSSDSSSYSDVEVVPTKKTEKELSMLPGISIIKAESLP 581 
  Fly   582 LSREDFERSLRCDEQVPQTPPKSSSSSSSGSHASEMSP 619  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| l(3)mbt | NP_733209.1 | MBT | 822..918 | CDD:214723 | |
| MBT | 929..1028 | CDD:214723 | |||
| MBT | 1038..1130 | CDD:214723 | |||
| SAM_PNT | 1279..1366 | CDD:280377 | |||
| phc2a | NP_694490.2 | Disordered. /evidence=ECO:0000250|UniProtKB:Q9QWH1 | 1..78 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 282..316 | 11/45 (24%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 482..545 | 19/69 (28%) | |||
| HD1 | 540..570 | 7/29 (24%) | |||
| PHC2_SAM_assoc | 646..756 | CDD:293222 | 33/170 (19%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 653..730 | 25/127 (20%) | |||
| SAM_Ph1,2,3 | 758..826 | CDD:188976 | |||
| SAM | 760..827 | CDD:197735 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||