DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Phc1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_006505561.1 Gene:Phc1 MGIID:103248 Length:1040 Species:Mus musculus

Alignment Length:878 Identity:185/879 (21%)
Similarity:296/879 (34%) Gaps:271/879 (31%)


  Fly     7 ASAEAKQL----QRNISLSMSPANGGVISPSTANCNGVASASGGNPNPNSLLTLAPRKEELRFLP 67
            |||:..|:    |:.|....||.:|  :|.:::....||.||.|....:              |.
Mouse   245 ASAQGPQMPGSTQKAIPPGASPVSG--LSQTSSQALAVAQASSGASGQS--------------LN 293

  Fly    68 LAPMGGNKTCNITISNVQPMKSKLKSVNIVPNSIKSAGAGATVGSADAPLFQLVPSPSNPSQPLV 132
            |:..||.                  |.|.:|.|:...|.|...|.    |.||      ||..|.
Mouse   294 LSQAGGG------------------SGNSLPGSMGPGGGGQAPGG----LGQL------PSSGLT 330

  Fly   133 AILAPNRKTTLLGGGASNGQPVVIRSGTPLHKNSLTVETSNKPIQPGGSAAAAAVGGGTG----G 193
            ....|.:.|.::       ||:.......:.:.|.|...|        :||..|...|:|    |
Mouse   331 GGSCPRKGTGVV-------QPLPAAQTVTVSQGSQTEAES--------AAAKKAEADGSGQQSVG 380

  Fly   194 APLTLVGKTVVPPK----IQAATPVQIPSTGPGAQVSLLANP----LKPRAPLILSKVAVDKLRL 250
            ..||   :|..|..    |.:||..||...      ||:...    |:.:..:|..::|:.. :.
Mouse   381 MNLT---RTATPAPSQTLISSATYTQIQPH------SLIQQQQQIHLQQKQVVIQQQIAIHH-QQ 435

  Fly   251 KFSQVKSNPNALVLGKANHVKKLLTSPNPSGEDKTRSTQKNNKQNTSASQLKPVVAPKTAMPIAT 315
            :|...:|.    :|..|.|::  |.......:.:.:..|:..:|....:.|.....|:  :|...
Mouse   436 QFQHRQSQ----LLHTATHLQ--LAQQQQQQQQQQQQQQQQQQQQQQGTTLTAPQPPQ--VPPTQ 492

  Fly   316 EVPTADNNKMSLIKSKPVAIKAVPLPSQEAPIVPAVAPVV-TSPEKVDVKPTAKPSIKTAPKPTP 379
            :||                    |..||:......|.|:: :||..:..:||:||.|....||..
Mouse   493 QVP--------------------PSQSQQQAQTLVVQPMLQSSPLTLPPEPTSKPPIPIQSKPPV 537

  Fly   380 KPLEMSVNGPAKEKKAPAKEQKQKTMDKPPVVKEIAQHTP---CGPKELPKLKRSKSFVSNHPAS 441
            .|::....|.||         ...|...||       |.|   .|.::              |.|
Mouse   538 APIKPPQLGAAK---------MSATQQPPP-------HIPVQVVGTRQ--------------PGS 572

  Fly   442 PVANNERRHSVAIMAKEVDVIEQPSAAIET---ITIEDDDESEEEQQKPEIKKTPKQNQKPEKQE 503
            ..|             :...:.|.:||:.|   ||      ...:..:..:..:|     |..|.
Mouse   573 AQA-------------QALGLAQLAAAVPTPRGIT------GAVQPGQAHLASSP-----PSSQA 613

  Fly   504 APKKKQIPMPILPAGITIS----TTSTAKKKAVRKNSSVTTISSSSSDSSSYSDVEVVPTKKTEK 564
            ||...|...|.|.||:|::    |....|......:..|..:.::....|.:             
Mouse   614 APGALQECPPALAAGMTLAPVQGTAHVVKGGPTASSPVVAQVPAAFYMQSVH------------- 665

  Fly   565 ELSMLPGISIIKAESLPLSREDFERSLRCD------------EQVPQTPPKSSSSSSSGSHASEM 617
                |||    ||::|.:.|:......|.|            ....::|......:|.|..|..:
Mouse   666 ----LPG----KAQTLAVKRKAESEEERDDLSALASVLPTKASPAAESPKVIEEKNSLGEKAEPV 722

  Fly   618 SP----PPK-----LADPKPSSPPAKNAKKAND-HDANP-----SPSSKTNDFKKSMMQNLNMLK 667
            :.    ||.     || |.||:||...|..:.. .|:.|     .|...|:..:..::|      
Mouse   723 ASLNANPPNSDLVALA-PTPSAPPPTLALVSRQMGDSKPPQAIVKPQILTHIIEGFVIQ------ 780

  Fly   668 WRGQQPANLQNSTVRFELNEFNFLQINERCQPRQG--PAAYFE-RPLYDRPGRRPSACVHPL--L 727
             .|.:|         |.:....||:  |..:|.|.  |....| :|.....|..||..:...  |
Mouse   781 -EGAEP---------FPVGCSQFLK--ETKKPLQAGLPTGLNESQPSGPLGGDSPSVELEKKANL 833

  Fly   728 YLCQRCNFHGPAADFL-APHFCSVGCVRR-----SQKRRLPQSTQK---ESKISRTQLEQTAGTA 783
            ..|:.|..:.||..|. :..|||:.|.:|     |.:.||.:...|   |:..:|.:......::
Mouse   834 LKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEASYARVRRRGPRRSS 898

  Fly   784 PDLPQKRQTNYKPHKSLSAIQEQLQQRQKDKPR 816
            .|:.:.:            ||.:..:.|:|..|
Mouse   899 SDIARAK------------IQGKRHRGQEDSSR 919

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
Phc1XP_006505561.1 zf-FCS 828..863 CDD:283998 11/35 (31%)
PHC2_SAM_assoc 864..970 CDD:293222 12/69 (17%)
SAM_Ph1,2,3 971..1039 CDD:188976
SAM 973..1040 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86471580
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.