DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Scml2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_006528733.1 Gene:Scml2 MGIID:1340042 Length:1136 Species:Mus musculus

Alignment Length:471 Identity:119/472 (25%)
Similarity:167/472 (35%) Gaps:134/472 (28%)


  Fly   569 LPGISIIKAESLPLSREDFERSLRCDEQVPQTPPKSSSSSSSGSHASEMSPPPKLADPKPSSPPA 633
            |.|...:.||..|.|.|..|            |......:.||...:|..||     ......||
Mouse    10 LAGSGELVAEPGPSSTEARE------------PATGVQLAGSGQLVAEQGPP-----STGGREPA 57

  Fly   634 KNAKKANDHD--ANPSPSSKTNDFKKSMMQNLNMLKWRGQQPANLQNSTVRFELNEFNFLQINER 696
            ...:.|...:  |.|.|||.                 ..::||..:.::   .|.:    |:.::
Mouse    58 TGVQLAGSGELVAEPGPSST-----------------EAREPATAEGTS---GLGQ----QVTKQ 98

  Fly   697 CQPRQG---PAAYFE----RPLYDRPGRRPSACVHPLLYLCQRCNFHGPAADFLAPHFCSVGCVR 754
            ..|..|   ||...:    ..|...||                                      
Mouse    99 GHPSTGEMEPATGVQLAGSGELVAEPG-------------------------------------- 125

  Fly   755 RSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQEQLQQRQKDKPRKPF 819
                   |.||:..   ..|:...|.|         ||..:.|                     |
Mouse   126 -------PSSTEAR---ENTEEANTMG---------QTANEDH---------------------F 150

  Fly   820 RWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSF 884
            .|.:|||..| .::||...|........|.|:|||||||.||.|....||.|::.:.|.||:|..
Mouse   151 DWDKYLKETG-SISAPSEYFRQSKTPPTNEFKIGMKLEARDPRNIDSVCVASVIGITGARLRLRL 214

  Fly   885 DGYSSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVK--TGGKAAPRALFGH 947
            ||..:..|||...||.||.|.|.|::...:||.|..|.....||..:|::  ||.:.||...|  
Mouse   215 DGSDNKNDFWRLVDSSDIQPVGTCEQGGDLLQPPLGYTLNTSSWPMFLLRVLTGSELAPAVFF-- 277

  Fly   948 LNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYI 1012
             ..:....::|.|.|||.:||.|..:...||.||:..:..:::.:.||||...:|.|....|..|
Mouse   278 -KEEPPRPLQNNFIVGMKIEAVDRKNPFMICPATIGAVCGDQLHITFDGWSGAFDYWCDYDSRDI 341

  Fly  1013 HPCGWHEGRQQLIVPP 1028
            .|.||......::.||
Mouse   342 FPVGWCRLTGDVLQPP 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 40/96 (42%)
MBT 929..1028 CDD:214723 30/101 (30%)
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
Scml2XP_006528733.1 MBT 153..248 CDD:214723 40/96 (42%)
MBT 266..357 CDD:214723 29/94 (31%)
DUF3588 877..986 CDD:288954
SAM_Scm 1062..1132 CDD:188977
SAM 1064..1132 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87425636
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.