DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and SCML2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_006080.1 Gene:SCML2 HGNCID:10581 Length:700 Species:Homo sapiens

Alignment Length:750 Identity:185/750 (25%)
Similarity:271/750 (36%) Gaps:240/750 (32%)


  Fly   788 QKRQTNYKPHKSLSAIQEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPIHLFLNPFPISP-NCFE 851
            :|......|..|.|::|           |..|.|.||||..| .::||...| ....|.| |.|:
Human    13 KKENQEKTPQSSTSSVQ-----------RDDFHWEEYLKETG-SISAPSECF-RQSQIPPVNDFK 64

  Fly   852 IGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETARVLQ 916
            :||||||.||.|.:..|:.:::.:.|.||:|..||..:..|||...||.||.|.|.|::...:||
Human    65 VGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQ 129

  Fly   917 APKDYNSERFSWSRYLVKT--GGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICV 979
            .|..|.....||..:|:||  |.:.|...||   ..:......|.|.|||.|||.|..:...||.
Human   130 PPLGYQMNTSSWPMFLLKTLNGSEMASATLF---KKEPPKPPLNNFKVGMKLEAIDKKNPYLICP 191

  Fly   980 ATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGWHEGRQQLIVPP---------------- 1028
            ||:.|:..:.:.:.||||...:|.|....|..|.|.||......::.||                
Human   192 ATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTSVPIVKNIAKTESS 256

  Fly  1029 ----------DYQKSAFIW-------DDYISEVGGMAASK-----ELFTPRQ--PMEYQERMKLE 1069
                      ..||:..|.       ...|...|..|..|     :..|||:  |...::...|.
Human   257 PSEASQHSMQSPQKTTLILPTQQVRRSSRIKPPGPTAVPKRSSSVKNITPRKKGPNSGKKEKPLP 321

  Fly  1070 VVDQRN---------------------PCLIRPATV---VTRKGYRVQLHLDCWPTEYYFWLEDD 1110
            |:...:                     ||.|..:||   |.:.| ....|||  |...     ..
Human   322 VICSTSAASLKSLTRDRGMLYKDVASGPCKIVMSTVCVYVNKHG-NFGPHLD--PKRI-----QQ 378

  Fly  1111 SPDLH----PIG--------WCEATSHELETPPGYLQPKS----VMPCDVEG---------CRGF 1150
            .|| |    |:.        .|...:.|.:|..|||:|.:    |:....:|         ....
Human   379 LPD-HFGPGPVNVVLRRIVQACVDCALETKTVFGYLKPDNRGGEVITASFDGETHSIQLPPVNSA 442

  Fly  1151 GNAKRFNLN-VHALRECC-------PY------------------APENWRQWRSKTVKP----P 1185
            ..|.||..| .|:|:  |       |:                  |.|:..:.:|....|    |
Human   443 SFALRFLENFCHSLQ--CDNLLSSQPFSSSRGHTHSSAEHDKNQSAKEDVTERQSTKRSPQQTVP 505

  Fly  1186 RVAPENIRRGWAKKTKRACSEA------------KQAIKEDSQQE----------------IVYP 1222
            .|.|.:.:   ..|||...||.            ::.:.|||:..                .::.
Human   506 YVVPLSPK---LPKTKEYASEGEPLFAGGSAIPKEENLSEDSKSSSLNSGNYLNPACRNPMYIHT 567

  Fly  1223 KVAE--------------VVQAKRKTSPCEEKVVKKQKQMQKEEDAEQ---VPDERSLAIARSFV 1270
            .|::              |.....|:||.|.|.     |||::.:|..   |||..  .:.:.|.
Human   568 SVSQDFSRSVPGTTSSPLVGDISPKSSPHEVKF-----QMQRKSEAPSYIAVPDPS--VLKQGFS 625

  Fly  1271 KDYGPQFLPNYRLWQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTD------IAKVIFEQDI 1329
            ||                          |..|:..:|.::::.    ||      :|.:..:.:|
Human   626 KD--------------------------PSTWSVDEVIQFMKH----TDPQISGPLADLFRQHEI 660

  Fly  1330 DGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLR 1364
            ||:||.:|....:..|:.||:|||:||...|..|:
Human   661 DGKALFLLKSDVMMKYMGLKLGPALKLCYYIEKLK 695

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 40/97 (41%)
MBT 929..1028 CDD:214723 33/101 (33%)
MBT 1038..1130 CDD:214723 28/135 (21%)
SAM_PNT 1279..1366 CDD:280377 22/92 (24%)
SCML2NP_006080.1 MBT 1 33..131 42/100 (42%)
MBT 36..131 CDD:214723 40/97 (41%)
MBT 2 139..240 35/104 (34%)
MBT 142..240 CDD:214723 33/101 (33%)
DUF3588 356..465 CDD:288954 28/120 (23%)
SAM_Scm 625..696 CDD:188977 24/101 (24%)
SAM 628..696 CDD:197735 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87426167
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.