DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and LOC103690158

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_017459433.1 Gene:LOC103690158 RGDID:9229975 Length:712 Species:Rattus norvegicus

Alignment Length:710 Identity:220/711 (31%)
Similarity:331/711 (47%) Gaps:123/711 (17%)


  Fly   732 RCNFHGPAADFLAPHFC-SVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDL--------- 786
            :|.:...|:...|...| :||  ||:::.|...:..:..:..|.:....||....|         
  Rat    32 KCGWGTEASPGKARTACHAVG--RRARQVRQEHARARRGRFPRPRPVHLAGRQWLLRGSGKTLLR 94

  Fly   787 ---PQKRQTNYKPHKSLSAIQEQLQQ------RQKDKP---------------RKPFRWSEYLKS 827
               .:.||.|.|...|:::.:...|.      .::.||               ::.:.|.:||: 
  Rat    95 NSEVEMRQPNRKRKLSMASTEHMNQDGRMGQTEEETKPGDGATPSGRESSVTTQETWSWEQYLR- 158

  Fly   828 KGKDVAAPIHLFL--NPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSM 890
            :|..||||:.||.  ..||...|.|::||:||.||....|:|||.|:.||.||||:|.||||.|.
  Rat   159 EGNAVAAPVELFSKDQSFPEHENGFQVGMRLEGIDARRPSVFCVLSVAEVCGYRLRLHFDGYLSC 223

  Fly   891 YDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMD 955
            ||||.||.|.||.|.|||.:|...|..|:||..::|.|..||.....:.||:.||  .|......
  Rat   224 YDFWTNAGSPDIHPVGWCQKTKHELHIPRDYRKDKFVWMDYLKACRLQNAPKKLF--RNRSSNGP 286

  Fly   956 VRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGW-HE 1019
            |...|.|||.:||.|..:...:|||||.||:::|:|||.|.|||.:|.|..::||.|.|.|| .|
  Rat   287 VPKEFQVGMKVEAVDRRNPCLMCVATVADIVEDRVRVHSDSWDDSFDYWCDVSSPCIQPVGWCQE 351

  Fly  1020 GRQQLIVPPDYQ-KSAFIWDDYISEVGGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPAT 1083
            ..:.|:.||.|. ...|.|.||:......|...:.|..|.|..:...:|||.||:|||.|||.||
  Rat   352 NGRNLVTPPGYPGPDKFSWADYLQATQAKAVPAKAFNTRAPHGFLPNLKLEAVDKRNPRLIRVAT 416

  Fly  1084 VVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGYLQPKSVMP----CDV 1144
            |.....|||::|.|.|..:|.:|::.||.|:||||||:.|.|.||.|.|....| ::|    |..
  Rat   417 VTDVDDYRVKIHFDGWDHKYDYWMDADSQDIHPIGWCDVTGHPLEVPYGSEHVK-ILPGQPSCPT 480

  Fly  1145 EGCRGFGNAKRFNLNVHALRECCPYAPENWRQWRSKTVKPPRVAPENIRRGWAKKTKRACSEAKQ 1209
            .||||.|:.:......|.....|||:..|.:                                ::
  Rat   481 PGCRGIGHIRGPRYAGHHSAFGCPYSDVNLK--------------------------------RE 513

  Fly  1210 AIKEDSQQEIVYPKVAEVVQAKRKTSP----------------CEE-----KVVKKQKQMQ---- 1249
            |..:|        ::.|..||..:..|                |||     ::|::.|.::    
  Rat   514 AALQD--------RLREQTQANLEFDPSHSKSENLCNLNFNGKCEEVDSECRLVQQAKCLKIKGR 570

  Fly  1250 ---------KEEDAEQVPDERSLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPL-HWTS 1304
                     :|..|.||.......::.:.:..:..:.||..|.........:.|::.:.: .||.
  Rat   571 EDTDLDNLFREYSASQVQQMLHQPLSMTSMSAHPFRDLPLGREQHCKLLPGVADIQASEVARWTV 635

  Fly  1305 WDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLR 1364
            .:|.|:::..|...:.||...::.|||:|.|:|.:.::...:::|:|||:|:|:.||..|
  Rat   636 DEVAEFVQSLLGCEEHAKCFKKEQIDGKAFLLLTQADIVKVMRIKLGPALKIYNSILMFR 695

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 51/98 (52%)
MBT 929..1028 CDD:214723 41/100 (41%)
MBT 1038..1130 CDD:214723 41/92 (45%)
SAM_PNT 1279..1366 CDD:280377 25/88 (28%)
LOC103690158XP_017459433.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.