DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Mbtd1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_006531947.1 Gene:Mbtd1 MGIID:2143977 Length:736 Species:Mus musculus

Alignment Length:781 Identity:176/782 (23%)
Similarity:259/782 (33%) Gaps:314/782 (40%)


  Fly   572 ISIIKAESL---PLSRED----FERSLRCDEQVPQTPPKSSSSSSSGSHASEMSPPPKLADPKPS 629
            |:.||.:::   |..:.|    |:....|.|.       :||||||.....|::|.|        
Mouse    19 ITAIKKQNILHNPKEKADWFGMFDGYDSCSED-------TSSSSSSEESEEEVAPLP-------- 68

  Fly   630 SPPAKNAKKANDHDANPSPSSKTNDFKKSMMQNLNMLKWRGQQPANLQNSTVRFELNEFNFLQIN 694
                                           .||.::|..||                       
Mouse    69 -------------------------------SNLPIIKNNGQ----------------------- 79

  Fly   695 ERCQPRQGPAAYFERPLYDRPGRRPSACVHPLLYLCQRCNFHGPAADFLA--PHFCSVGCVRRSQ 757
                            :|..|..:..      :..|:.|...|....|.:  ..||||.|     
Mouse    80 ----------------VYTYPDGKSG------MATCEMCGMVGVRDAFYSKTKRFCSVSC----- 117

  Fly   758 KRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQEQ---------------L 807
            .|....:::|.|.::|.|:               |...|.|....:|:|               |
Mouse   118 SRSYSSNSKKASILARLQV---------------TGKPPTKKAKVLQKQPLVAKLAAYAQYQATL 167

  Fly   808 QQRQKDKPR------KPFRWSEYLKSKGKDVAAPIHLFLN-PF-----PISPNCFEIGMKLEAID 860
            |.:.|.|..      :.|.|..|:.| ...:|||:..|.: |.     .||.|     :::| :.
Mouse   168 QNQAKTKAGNSAISVEGFSWGNYINS-NSFIAAPVACFKHAPMGTCWGDISEN-----VRIE-VP 225

  Fly   861 PENCSL----FCVCSIVEVRGYRLKLSFDGY--SSMYDFWVNADSQDIFPPGWCDETARVLQAPK 919
            ..:|||    |.:..|:::.||...|.::|:  .|..|||.|....||.|.|||..:.:.|..|:
Mouse   226 NTDCSLPTKVFWIAGIIKLAGYNALLRYEGFENDSSLDFWCNICGSDIHPVGWCAASGKPLVPPR 290

  Fly   920 DYNSERFSWSRYLVK--TGGKAAP----------------------------------------- 941
            ....:..:|..:|||  ||.|..|                                         
Mouse   291 TVQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRVEVVDKRHLCRTRVAVVESVI 355

  Fly   942 -----------------------RALFGHLNMQQQMDVR-------------------------- 957
                                   ..|..|:...:.:..|                          
Mouse   356 GGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSDITKKQDGHFDTPPHLFAKVKE 420

  Fly   958 -----NGFAVGMHLEAEDLNDTGKICVATVTDIL-DERIRVHFDG--------WDDCYDLWVHIT 1008
                 ..|..||.|||.|..:...|||||:..:| |..:.:..||        | .||    |.|
Mouse   421 VDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGIDGSEAADGSDW-FCY----HAT 480

  Fly  1009 SPYIHPCGWHEGRQQLIVPP-DYQKSAFIWDDYISEVGGMAASKELFTPRQPME-YQERMKLEVV 1071
            ||.|.|.|:.|.....:.|| .|.|..|.|.||:.|.|.:||..:||....|.. ::..||||.|
Mouse   481 SPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPVKLFNKDVPNHGFRVGMKLEAV 545

  Fly  1072 DQRNPCLIRPATVVTRKGYR-VQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGYLQ 1135
            |...|.||..|| |||..:| :::|.|.|..||..|::.:||||:|:|||:.|.::|:.|     
Mouse   546 DLMEPRLICVAT-VTRIIHRLLRIHFDGWEEEYDQWVDCESPDLYPVGWCQLTGYQLQPP----- 604

  Fly  1136 PKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPYAPENWRQWRSKTVKPPRVAPENIRRGWAKKT 1200
                                              |.::.|:.:|.:.|..:.|.....:|..||.
Mouse   605 ----------------------------------ASQSSRESQSASSKQKKKAKSQQYKGHKKKR 635

  Fly  1201 K 1201
            |
Mouse   636 K 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 32/108 (30%)
MBT 929..1028 CDD:214723 38/205 (19%)
MBT 1038..1130 CDD:214723 40/94 (43%)
SAM_PNT 1279..1366 CDD:280377
Mbtd1XP_006531947.1 MBT 189..289 CDD:214723 32/107 (30%)
MBT 306..396 CDD:214723 7/90 (8%)
MBT 403..500 CDD:214723 28/102 (27%)
MBT 512..604 CDD:214723 40/93 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.