DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Samd11

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_008762634.1 Gene:Samd11 RGDID:1310271 Length:665 Species:Rattus norvegicus

Alignment Length:509 Identity:103/510 (20%)
Similarity:169/510 (33%) Gaps:126/510 (25%)


  Fly  1007 ITSPYI-HPCGWH-----EGRQQLIVPPDYQKSAFIWDDY------ISEVGGMAASKELFTPRQP 1059
            ::.||| ..|...     :..|:.::.|:.:.:....|.|      :||.|....::.|:....|
  Rat   151 LSCPYITSDCSSEKKARSKAPQETLLLPELESTMAPEDHYHQLMSALSEAGPFEETQRLYHLGIP 215

  Fly  1060 MEYQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLH-----PIGW 1119
            .....|::.||           ||...|....:::||   |:.............|     |...
  Rat   216 SHDLLRVRQEV-----------ATATLRGPSSLEVHL---PSSTAGHRRKQGLVQHREGTVPAAT 266

  Fly  1120 CEATSHELETPPGYLQPKSV---------------MP---CDVEGCRGFGNAKRFNL--NVHALR 1164
            ...:..||..||..|.|::.               ||   |...|.....:|:...|  ....||
  Rat   267 TSFSERELSQPPPLLPPQNAPHITMGSHLRPPFFGMPTALCQTPGYSFLPSAQAEMLARQQELLR 331

  Fly  1165 ECCPYAPENWRQWRSKTV----KPPRVAPENI-----------RRGWAKKTKRACS--------- 1205
            :......|.....|.|.:    :|..:|||..           |||.....|...:         
  Rat   332 KQSLARLEMSELLRQKELGSVHRPQLLAPEVALHIPEGPDELQRRGSMLVLKHGSAPLLALPPQG 396

  Fly  1206 --------EAKQAIKEDSQQEIVYPKVAEVVQAKRKTSP--CEEKVVKKQKQMQKEEDAE----- 1255
                    .||::.:..||:..:....|:..:.|..|..  ..:.|.::..:....||.|     
  Rat   397 PPGPGPPIPAKESARSRSQKGSLGAASAQPSEPKETTRAGLWAQDVSEEPSKDSDGEDPEIAAAR 461

  Fly  1256 -------QVPDERSLAIARSFVKDYG-PQFL----------PNYRLWQLNSAFKLDDVRTNP--- 1299
                   |||...:.|..:..:.... |..|          |.:....:...| .|:..|.|   
  Rat   462 GGASTPSQVPAGGTRAEGKGLLSGSTLPPPLPLGFPCGAVSPYFHTGTMGGLF-TDEETTGPEDI 525

  Fly  1300 LHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNL- 1363
            ..||..|||.::.......:.|:|..||.|||..|.:|..:.|...:.||:|||:|:.:.:... 
  Rat   526 NKWTVDDVCNFVGGLSGCGEYARVFREQGIDGETLPLLTEEHLLNTMGLKLGPALKIRAQVAKRL 590

  Fly  1364 -RIAVVCKFDSKNIELESNTAGPIQR-EMDTPV--SAIKQLPEQSQTNGYKTDH 1413
             |:..:..|.         .|.|:|. .:..||  ...:.|...:.|:.|:..|
  Rat   591 GRVFYMASFP---------VALPVQTPSLQAPVLSPGHQPLSPATTTSPYEGTH 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723 5/27 (19%)
MBT 1038..1130 CDD:214723 20/103 (19%)
SAM_PNT 1279..1366 CDD:280377 27/92 (29%)
Samd11XP_008762634.1 SAM_Samd7,11 525..592 CDD:188978 21/67 (31%)
SAM 527..582 CDD:197735 21/55 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87356568
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.