DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and samd1b

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_005163590.1 Gene:samd1b ZFINID:ZDB-GENE-090313-2 Length:626 Species:Danio rerio

Alignment Length:540 Identity:106/541 (20%)
Similarity:177/541 (33%) Gaps:184/541 (34%)


  Fly     9 AEAKQLQRNISLSMSPANGGVISPSTANCNGVASASGGNPNPNSLLTLAPRKEELRFLPLAPMGG 73
            |.|.:.:|    |:|.|.||...|..|:..|....|.|:...:.    ...||:           
Zfish   178 ASASKERR----SVSAAGGGGSGPRDASSAGEEMLSAGHEGTDE----EEEKEQ----------- 223

  Fly    74 NKTCNITISNVQPMKSKLKSVNIVPNSIKSAGAGATVGSADAPLFQLVPSPSNPSQPLVAILAPN 138
             |||:...|   |.|::|.:    |:.:|....|:.|..:|                     :|.
Zfish   224 -KTCSSVSS---PQKNRLSA----PSKLKPGVKGSAVRGSD---------------------SPE 259

  Fly   139 RKTTLLGGGASNGQPVVIRSGTPLHKNSLTVETSNKPIQPGGSAAAAAVGGGTGGAPLTLVGKTV 203
            ..:|.||....:    .:||.:..|:               ||||       |.|.         
Zfish   260 ENSTDLGDRLMD----AVRSMSERHR---------------GSAA-------TRGH--------- 289

  Fly   204 VPPKIQAATPVQIPSTG-PGAQVSLLANPLKPRAPLILSKVAVDKLRLKFSQV-----------K 256
            .||.::..........| ||.:::      :.|..::|.: .:::.||:.:::           .
Zfish   290 APPGLKEILDYLCTQKGMPGEKLT------RNRVKVVLER-EIERGRLRRTRLGHITLPARGMGA 347

  Fly   257 SNPNALVLGKANHVKKLLTSPNPSGEDKTRSTQKNNKQNTSASQLKPVVAPKTAMPIATEVPTAD 321
            :.|:|.:|..|...:.|........||......:.|                     .||.|||:
Zfish   348 AKPSARLLKSALQDRHLAKKEELKDEDGMEVESEGN---------------------GTEEPTAE 391

  Fly   322 NNKMSLIKSKPVAIKA---VPLPSQEA--------PIVPAVAPVVTSP-----------EKVDVK 364
            :...::....||::|.   .|.|..||        |::.......||.           ::.||.
Zfish   392 DLPETVPDEDPVSVKTGTEPPSPEMEAESDHATRSPMMTCEGESQTSSSLQLSNHCSILQQADVG 456

  Fly   365 PTAKPSI--KTAPKPTPKPLEMSVNGPAKEKKAPAKEQKQKTMD---KPPVVKEIAQHTPCGPKE 424
            .:.:.::  :.....|.||.:.|      :::.|:.|.:...|.   |||  ..|.....|    
Zfish   457 ESQEQTMCAEAEDSGTEKPADPS------DQRHPSVEDQMLVMSETVKPP--SSIPIRNCC---- 509

  Fly   425 LPKLKRSKSFVSNHP-ASPVANNER--RHSVAIMAKEVDVIEQ-----------------PSAAI 469
              ||:...|.....| |||.|..||  ...:..:..|..|:..                 |..||
Zfish   510 --KLEVGVSSCLLTPSASPGAAEERGMNEGIGFVKSESSVVSPVDWTVADVASYFTAAGFPEQAI 572

  Fly   470 ETITIEDDDESEEEQQKPEI 489
            ...|.|.|.:|....|:.::
Zfish   573 AFRTQEIDGKSLLLMQRNDV 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
samd1bXP_005163590.1 SAM_Atherin-like 550..618 CDD:188982 8/44 (18%)
SAM 550..617 CDD:197735 8/44 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.