DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and LOC101883783

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_005158372.2 Gene:LOC101883783 ID: Length:490 Species:Danio rerio

Alignment Length:61 Identity:24/62 (39%)
Similarity:37/62 (60%) Gaps:3/62 (5%)


  Fly  1298 NPLHWTSWDVCEYIERALDST--DIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKL 1356
            :|..||..||.::| |.:|..  ..|.:..:.:|||:|||:|....:..|:.||:|||:||
Zfish   418 DPNLWTVEDVMQFI-RDIDPQLGPHADLFRKHEIDGKALLLLRSDVMMKYMGLKLGPALKL 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377 24/62 (39%)
LOC101883783XP_005158372.2 RBR 38..88 CDD:319226
RBR 105..152 CDD:319226
SLED 186..294 CDD:314933
SAM_Scm 416..486 CDD:188977 24/62 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86853947
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.