DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and phc3

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_004914480.1 Gene:phc3 XenbaseID:XB-GENE-6258800 Length:973 Species:Xenopus tropicalis

Alignment Length:1139 Identity:207/1140 (18%)
Similarity:364/1140 (32%) Gaps:395/1140 (35%)


  Fly   436 SNHPASPVANNERRHSVAIMAKEVD--------------VIEQPSAAIETI-------------T 473
            :|.|...|..:..||:|.::.:.::              ..:|....::|.             |
 Frog    22 ANPPPISVYGSSDRHAVQVIQQALNRPTSSAAQYLQQMYSAQQQHLMLQTAALHQQHLNSSPLQT 86

  Fly   474 IEDDDESEEEQQKPEIK--KTPKQNQKPEKQEAPKKKQIPMPILPAGITISTTSTA-KKKAVRKN 535
            |....:|....::|.|.  .|.:|:..|:..........|..:|....|.||||:: .:|.|...
 Frog    87 ISSVQQSNVTGERPSISSVSTTQQSNAPQTSIQLSTSPPPPQLLSRSQTSSTTSSSITQKTVLLG 151

  Fly   536 SSVTTISSSSSDSSSYSDVEVVPTKKTEKELSMLPGISIIKAESLPLSREDFERSLRCDEQVPQT 600
            |:..|:  |:|.:..|...::         |...|..::...:|                .:|..
 Frog   152 STSPTL--SASQAQMYLRAQM---------LIFTPAATVAAVQS----------------DIPVI 189

  Fly   601 PPKSSSSSSSGSHASEM---SPP------PKLADPKPSS---PPA-------------------K 634
            ...||||||..|....:   |.|      |..:.||||:   |.|                   :
 Frog   190 SSSSSSSSSCQSATQNLTIRSQPMLEMSFPNNSPPKPSNQDQPLAICHKTTVASSKTIHTDATME 254

  Fly   635 NAKKAND---HDANPSPSSKTNDF---------------------------------KKSMMQNL 663
            |.:| ||   .|:..:..::|::.                                 ::.::|..
 Frog   255 NNQK-NDSSMSDSRCTAVTRTSNIHQLIAPVSYSTVHSHSLGKHPAISILPDHPKLPQQVILQQQ 318

  Fly   664 NMLKWRGQ-QPANLQNSTVR-------FELNEFNFLQI-----NERC--------------QPRQ 701
            ..::.|.| |...|.||.:.       ..:...:|:.|     :..|              ||.|
 Frog   319 QQIQHRHQIQTITLHNSALEPPSTQHCVPMQSQSFVHIPSSAHSHHCTPVTTALSPPPTISQPAQ 383

  Fly   702 GPAAYFERPLYDRPGRRPSACVHP---------LLY---LCQRCNFHGPAADFL--APHFC---- 748
             |:.....|....|.:.|:..:||         ||.   |..|.|.|.|....|  ||...    
 Frog   384 -PSVVVSPPPPHSPCQSPTIIIHPQAIIQPQTSLLVQSTLPTRDNLHHPLQTTLHSAPQMSLSTH 447

  Fly   749 ---SVGCVRRSQKRRLPQSTQKESKISRTQLEQ-------TAGTAPDLPQKRQTNYKPHKSLSAI 803
               ::......|...:..|.|..|.||:||..:       |..::|.||.      .|...|.|:
 Frog   448 LPPTLSSGPHQQHALVSSSPQIISPISQTQQPEIQSIPTPTVASSPHLPT------TPPSQLQAL 506

  Fly   804 QEQLQQRQKDKP----------RKPFRWSEYLKSKGKDVAAP-----------IHLFLNPFPI-S 846
            ..|..|....:|          :......|.|.:....|..|           ::|.:.|..: |
 Frog   507 PLQSMQTIPVQPEILTPGQVLMQNALLTEEELPAAEALVQLPFQTLPPPQTVAVNLHIQPAAVES 571

  Fly   847 PNCFEIGMKLEAIDPENCSL--FCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCD 909
            |..:::    |.:.||...:  .||..|.:.|.....|..|         :...|.:..||   |
 Frog   572 PVVYQV----ENVCPEEAVVQEDCVGVITQTRTPPTMLPSD---------LPESSGEGLPP---D 620

  Fly   910 ETARVL------------QAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAV 962
            .|.|||            ::|.|.:....            .||..|......:....::.....
 Frog   621 PTLRVLPSITSSVGASVIKSPSDTSHMSI------------PAPPLLLPAATTRSNRTLKPNSIP 673

  Fly   963 GMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGWHEGRQQLIVP 1027
            |:          .|:..|.|..                 .:..|:...::        .|:.:.|
 Frog   674 GL----------DKLPHAIVKP-----------------QILTHVIEGFV--------IQEGVEP 703

  Fly  1028 PDYQKSAFIWDDYISEVGGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPATVVTRKGYRV 1092
            ....:|:.:.:..:                :|:...:...|.:.|.::.  |:.:..:....   
 Frog   704 FPVNRSSLLVEQAV----------------KPLSPLDEGNLNIADMKSD--IQSSAKLPDNS--- 747

  Fly  1093 QLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGYLQPKSVMPCDVEGCRGFGN----- 1152
                          .:.|..||.....|   ..|||.        .::.|:..|..|:.|     
 Frog   748 --------------TDTDMEDLTAEADC---MDELEC--------ELLACEFCGKTGYPNKFRQS 787

  Fly  1153 --------AKRFNLNVHALRECCPYAPENWRQWRSKTVKP------PRVAPENIRRGWAK-KTKR 1202
                    |||:|.|  :.::...:......:|..|....      |..:..::|..:.: :...
 Frog   788 ERFCSLSCAKRYNAN--STKQLGLFKANKTSRWSRKVDGSIGQRGRPSSSAGSVREHYLRQQLPT 850

  Fly  1203 ACSEAKQAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQMQKEEDAEQVPDERSLAIAR 1267
            |.|...:|: |:||::..  :|....:.:|::.  .|:..::::||:|.      |.:||     
 Frog   851 AYSYTSEAL-ENSQEDST--RVTMTTRLRRQSE--REREERQRRQMRKP------PCQRS----- 899

  Fly  1268 SFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGR 1332
                                     .|.:|.|..||..||..:|.......|||.....|:|||:
 Frog   900 -------------------------PDTQTEPSLWTVEDVWAFIHALPGCHDIADEFRTQEIDGQ 939

  Fly  1333 ALLMLGRKELDTYLKLKVGPAVKLYSLILNLRIA 1366
            |||:|....|...:.:|:|||:|:.:.|.:|:::
 Frog   940 ALLLLKEDHLMGTMNIKLGPALKICAWINSLKVS 973

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 25/122 (20%)
MBT 929..1028 CDD:214723 10/99 (10%)
MBT 1038..1130 CDD:214723 11/92 (12%)
SAM_PNT 1279..1366 CDD:280377 27/87 (31%)
phc3XP_004914480.1 SAM_Ph1,2,3 904..971 CDD:188976 26/67 (39%)
SAM 906..971 CDD:197735 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.