DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and samd7

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_004914482.1 Gene:samd7 XenbaseID:XB-GENE-948462 Length:534 Species:Xenopus tropicalis

Alignment Length:507 Identity:107/508 (21%)
Similarity:185/508 (36%) Gaps:137/508 (27%)


  Fly  1005 VHITSPYIHPCGWHEG--RQQLIVPPDYQKSAFIWDDYISEVGGMAASKELFTPRQPMEYQERMK 1067
            :|:.|.:.|....|.|  ..::...|.|   .|:..|.:..|   |..:||.....    ..||:
 Frog    94 LHVASQFGHSLPAHTGILSNRVFSSPGY---GFLQTDPMDFV---ARRQELLQKHN----MNRME 148

  Fly  1068 LEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDL-HPIGWCEATSHELETPP 1131
            || ::...|.  |......|||:.                :.::|.| |.|     :|:.:....
 Frog   149 LE-MNAMYPA--RDIDKSQRKGFN----------------DLEAPFLFHGI-----SSNPMAVRG 189

  Fly  1132 GYLQPKSVMPCDVEGCRGFGNAKRF-NLNVHA-LRECCPYAPENWRQWRSKTVKPPRVAPENIRR 1194
            ..:.|:..:|.||     |.:...| :|:.|| |:...|| |......|.:..:|.|      |.
 Frog   190 RQMVPEGHLPSDV-----FVHRNAFESLHGHAMLKTASPY-PSMSNLQRERARRPGR------RA 242

  Fly  1195 GWAKKT------------KRACSEAKQAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQ 1247
            |..|.|            |.....|....::|.:::.....:::..|.|.:..|..:|...:.:.
 Frog   243 GNQKATDHMGVAKIQADNKPPSPPAPTDEEKDEKKDEETGTMSKCDQIKTEVQPALDKSSSELQD 307

  Fly  1248 MQKEEDAEQVPDERSLAIARSFVKDYGPQ-----FLPNYRLWQ---------------LNSAF-- 1290
            .||..: :.:|  |.:|..||.: |.||.     |...| ::|               :||..  
 Frog   308 PQKMSN-QNIP--REIANGRSEM-DKGPNNTGTAFEERY-IYQPPVHLSATPYSFPVAMNSPLLP 367

  Fly  1291 -------------KLDDVRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKEL 1342
                         .::|:|    .|.|.||..:|......:..|:|..:.||||..|.:|..:.|
 Frog   368 GTQGLFLTREDLPSVEDIR----KWNSQDVYNFILNLPGCSSYAQVFKDHDIDGLTLPLLTEEHL 428

  Fly  1343 DTYLKLKVGPAVKLYSLILNLRIAVVCK----FDSKNIELESNTAGPIQREMDTPVSAIKQLPEQ 1403
            ...:.||:|||:|       :|..::|:    |...:::|..:.:.......:.|...:..||  
 Frog   429 LDTMGLKLGPALK-------IRSQIICRLGNIFHMPSLQLTGSISSTAPMPPEHPSEVVSPLP-- 484

  Fly  1404 SQTNGYKTDHDQELSESGDDDDDEDVMLDSDDFLSVKPSCLVIDEDADGDGD 1455
                  .|::...|...|..|.|           .:||..:::.|:.:...|
 Frog   485 ------CTNNSDILPSPGPQDQD-----------PLKPGEIIMSENKENPCD 519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723 5/25 (20%)
MBT 1038..1130 CDD:214723 19/93 (20%)
SAM_PNT 1279..1366 CDD:280377 27/117 (23%)
samd7XP_004914482.1 SAM_Samd7,11 385..452 CDD:188978 23/78 (29%)
SAM 387..446 CDD:197735 21/66 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87204158
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.