DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and l3mbtl1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_002932913.2 Gene:l3mbtl1 XenbaseID:XB-GENE-949999 Length:757 Species:Xenopus tropicalis

Alignment Length:875 Identity:263/876 (30%)
Similarity:389/876 (44%) Gaps:195/876 (22%)


  Fly   554 VEVVPTK-KTEKELSMLPGISIIKAESLPLSREDFERSLRCDEQVPQTPPKSSSSSSSGSHASEM 617
            ::::.|| |:|.|:|...|....:...|..|.:        .:.|.|.||         :.:|||
 Frog     1 MDLIVTKAKSEPEISAPSGKVTSEGTGLLASSQ--------TQAVVQLPP---------AFSSEM 48

  Fly   618 SPPPKLADPKPSSPPAKNAKKANDHDANPSPSSKTNDFKKSMMQNLNMLKWRGQQ---PANLQNS 679
            ..|.::  .|..:.|.|.|..|.              |.         .:|...|   |.:.|::
 Frog    49 QHPQQM--EKKGAEPVKVAVNAR--------------FP---------FRWSEPQEGIPRSPQDN 88

  Fly   680 TVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSACVHPLLYLCQRCNFHGPAADFLA 744
            .:  |:.|.::...::..:.|.|........|.|..|     |.|.:...|:.|   |....|..
 Frog    89 PI--EVQETDYQTSSQDAEGRTGSPTDSGLSLCDTCG-----CRHMVGGTCETC---GDICGFKE 143

  Fly   745 PHFC------------SVGCVRRSQKRRLPQSTQK--ESKISRTQLEQTAGTAPDLPQKRQTNYK 795
            ...|            ..|...:..|:|.|:..|.  ||:...||.|          ||...:.:
 Frog   144 SVHCRSLVMETSLVFGGGGETPKPVKKRRPKEYQSPAESEAEFTQKE----------QKSTGHIE 198

  Fly   796 PHKSLSAIQEQLQQR----QKDKPRKPFRWSEYLKSKGKDVAAPIHLFLNPFPIS---PNCFEIG 853
            ...:.|.::|:..||    ..|:..:|:.||.|| .:.|.:|||::|| ..:.:.   .|.|::|
 Frog   199 ESLARSCVKEEWSQRDIRVSGDELGEPWSWSTYL-DELKCIAAPLNLF-REWQLGAQHKNSFKVG 261

  Fly   854 MKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETARVLQAP 918
            ||||.|||::.||:.:.::.||.|:|::|.|||||..:||||||||.||.|.|||:.|...||.|
 Frog   262 MKLEGIDPQHPSLYFILTVTEVCGFRIRLHFDGYSDCHDFWVNADSPDIHPAGWCERTGHKLQPP 326

  Fly   919 KDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNG-----FAVGMHLEAEDLNDTGKIC 978
            |.|..|.|||:.||.:|....||:.||        :..:.|     |.|||.|||.|..:...||
 Frog   327 KGYKDEDFSWTNYLRQTKAPVAPKHLF--------VTPKIGAPPSLFRVGMKLEAVDRMNPSLIC 383

  Fly   979 VATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGWHEGRQQLIVPP-DY-QKSAFIWDDYI 1041
            ||:|||::::|..||||.|.|.||.|...:|||:||.||.|..::::.|| || ....|.|..|:
 Frog   384 VASVTDVIEDRFLVHFDNWGDTYDYWCDPSSPYVHPVGWCEQHEKILTPPQDYPDPEGFSWGKYL 448

  Fly  1042 SEVGGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFW 1106
            ||...:|...:.|.||.|..::..|:||.||:|:|.||..|:||..:.:|:::|.|.|...|.||
 Frog   449 SETKTVAVPAQAFHPRPPHGFKVDMRLEAVDRRSPSLICVASVVEVEEFRIKVHFDGWSHMYDFW 513

  Fly  1107 LEDDSPDLHPIGWCEATSHELETP----------PG-----------------Y-LQPKSVMPCD 1143
            |:.|.|||||.||.:.|.|.|:||          ||                 | ||.:.   |.
 Frog   514 LDADHPDLHPAGWSQRTGHPLQTPLRCRDVSNMSPGPCVSLSCKEMSHTRNNKYGLQHRK---CP 575

  Fly  1144 VEGCRGFGNAK-RFNLNVHALRECCPYAPENWRQWRSKTVKP---PRVAPENIRRGWAKKTKRAC 1204
            ..||.|.|:.. ||  ..|.....||.|..|....||:...|   .|.:..:.|.|...|.:|  
 Frog   576 TPGCDGSGHVTGRF--TAHHCLSGCPLADRNQNPTRSRNPIPFPSRRKSRHHGRIGRPPKYRR-- 636

  Fly  1205 SEAKQAIKEDSQQEIVYPKV---AEVVQAKRKTSPCEEKVVKKQKQMQKEEDAEQVPDERSLAIA 1266
                  :::||.|:.|:...   |..|...|..|.|.|:..:                       
 Frog   637 ------VQQDSYQDPVHQSFFMSALSVHPDRAHSHCWEQHCR----------------------- 672

  Fly  1267 RSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDG 1331
                      .||.......::..|          |::.:|..:::......|.|::..|:.|||
 Frog   673 ----------LLPGVAGISASTVSK----------WSTEEVFSFVQTLTGCEDQARLFREEMIDG 717

  Fly  1332 RALLMLGRKELDTYLKLKVGPAVKLYSLIL 1361
            :|||:|.:.::...|.:|:|||||:|:.||
 Frog   718 QALLLLTQTDIVKILCIKLGPAVKIYNSIL 747

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 48/99 (48%)
MBT 929..1028 CDD:214723 42/104 (40%)
MBT 1038..1130 CDD:214723 40/92 (43%)
SAM_PNT 1279..1366 CDD:280377 24/84 (29%)
l3mbtl1XP_002932913.2 MBT 231..326 CDD:214723 47/97 (48%)
MBT 338..433 CDD:214723 42/103 (41%)
MBT 446..537 CDD:214723 40/91 (44%)
zf-C2HC 573..599 CDD:279824 9/31 (29%)
SAM 685..752 CDD:197735 23/74 (31%)
SAM_Scm-like-3MBT3,4 685..750 CDD:188981 23/74 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87056603
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.647 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.700

Return to query results.
Submit another query.