DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and sfmbt2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_017947831.1 Gene:sfmbt2 XenbaseID:XB-GENE-1217645 Length:909 Species:Xenopus tropicalis

Alignment Length:879 Identity:178/880 (20%)
Similarity:277/880 (31%) Gaps:343/880 (39%)


  Fly   819 FRWSEYLKSKGKDVAAPIHLFLNPFPIS-PNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKL 882
            |.|.|||:..... |.| |.......|| .:.|:.|||||..:..|...:.|.:|:...|..|.|
 Frog    46 FNWDEYLEESASS-AVP-HTSFKHVEISLQSSFQPGMKLEVANKSNPDTYWVATIITTCGQLLLL 108

  Fly   883 SFDGYSS--MYDFWVNADSQDIFPPGWCDETARVLQAP---------------------KDYNSE 924
            .:.||..  ..|||.:..:.|:.|.|||.:..::|..|                     .....|
 Frog   109 RYCGYGEDRKADFWCDVMTADLHPIGWCTQNNKLLMPPDAAVGAIVFQRQQHFHVSNATTAIKEE 173

  Fly   925 RFSWSRYLVK--TGGKAAP-RALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDIL 986
            ...|:.||:.  ||.:.|| :.|.|.|..:..:|:....::   :|.:|..:..:.....|.:.:
 Frog   174 CTDWAEYLIHDLTGSRTAPAKLLEGPLRGKTPVDLITADSL---MELQDNQNPFQYWTVHVIENI 235

  Fly   987 DERIRVHFDGWD--DCYDLWVHITSPYIHPCGWHEGRQQLIVPP--------------------- 1028
            ..|:|:.:.|.:  |.:|.|:......:.|.||.:..|..:.||                     
 Frog   236 GGRLRLRYVGLEESDSWDQWLFYLDYRLRPVGWCQENQFRMDPPTDLCPLQSISEWKSALEKSLA 300

  Fly  1029 ----------------------------------------------------------------- 1028
                                                                             
 Frog   301 KAERCPLPVEVFKDHADLRSHSLTYGMKVEVVDPEEYTCIRPATVTKVFNNLYFQVTVDDLRPEA 365

  Fly  1029 -------------------------------DYQKSAFIWDDYISEVGGMAASKELF-TPRQPME 1061
                                           .|....|.|.||..:.|..||...|| .......
 Frog   366 KGVSMLCHADSLALLPVQWCLINGVNLTPPIGYPGQDFDWADYQKQCGAEAAPHTLFRNSSSSWG 430

  Fly  1062 YQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCW--PTEYYFWLEDDSPDLHPIGWCEATS 1124
            :.:.||||.|:.|||..|..|:|...||..:.|||:..  |...|. ::.:|.|:.|:|||||.|
 Frog   431 FTKDMKLEAVNPRNPAEICVASVTKVKGRLLWLHLEGLQKPVPEYI-VDVESMDIFPVGWCEANS 494

  Fly  1125 HELETP----------PGYLQPKSVMPCDV--------------EGCRGFGNAKRFNLNVHALRE 1165
            :.|.||          ...:||:..:|..|              ....|..|.|          .
 Frog   495 YPLSTPLKAAVKKKRKVAVVQPEKQLPSSVPLETIPQEPSPFPDNNLSGTANGK----------Y 549

  Fly  1166 CCPYAPENWRQWRSKTVKPPRVA--PENIRRG--------------------------------- 1195
            |||....|.|.:....:...|:|  |:::..|                                 
 Frog   550 CCPQLFINHRCFSGPFLNKGRIAELPQSVGPGKCVLVLKEVLGMVINAAYKPGRVLRELQLVEDS 614

  Fly  1196 -W--------AK---KTKRA-----------------------------------------CS-- 1205
             |        ||   ||.||                                         ||  
 Frog   615 LWNFQEETLKAKYKGKTYRATVKIVRTSDQVPDFCRKICSKLECCPNLFSPLLITDMCPENCSVH 679

  Fly  1206 -EAKQAIKEDSQQEIVYPKVAE--------------------VVQAKRKT-----SPCE------ 1238
             :.|.......:::|..|.|.|                    .||.||:|     ||.|      
 Frog   680 TKTKYTYYYGKRKKITKPSVGEQSLESVQAKPTRRRKRRKSIFVQKKRRTSTIDISPVESAEESI 744

  Fly  1239 -----------EKVVKKQKQMQKEEDAEQVPD---ERSLAIARSFVKDYGPQFLPNYRLWQLNSA 1289
                       |:...:.:..|.:..:.:||.   :|::.:....|.:..|....:.|..:..|.
 Frog   745 EDELMDDETGSEETSSELRDDQTDTSSAEVPSVRPQRAVTLRNRIVSERAPPVERSRRDRKTRSL 809

  Fly  1290 FKLDD-----------------VRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLML 1337
            ..:|.                 :.:|||.||..||..:| ::.|...:||:..:|||||:|||:|
 Frog   810 SSIDGDKDITMKADMKEEEHLVLESNPLQWTVTDVVRFI-KSTDCAPLAKIFQDQDIDGQALLLL 873

  Fly  1338 GRKELDTYLKLKVGPAVKLYSLILNLRIAVVCKF 1371
            ....:...::||:|||:||...|..:::|...::
 Frog   874 TLPTVQECMELKLGPAIKLCHQIERVKVAFYAQY 907

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 31/99 (31%)
MBT 929..1028 CDD:214723 24/104 (23%)
MBT 1038..1130 CDD:214723 36/95 (38%)
SAM_PNT 1279..1366 CDD:280377 31/104 (30%)
sfmbt2XP_017947831.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86666277
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.