DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and scml4

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_002937206.1 Gene:scml4 XenbaseID:XB-GENE-954903 Length:403 Species:Xenopus tropicalis

Alignment Length:64 Identity:23/65 (35%)
Similarity:38/65 (58%) Gaps:8/65 (12%)


  Fly  1298 NPLHWTSWDVCEYIE----RAL-DSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKL 1356
            :|.:|:..||..:::    :|| ...|:.:   :.:|||.|||:|....:..||.||:|||:||
 Frog   331 DPSNWSVEDVVWFVKDADPQALGPHVDLFR---KHEIDGNALLLLRSDMVMKYLGLKLGPALKL 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377 23/65 (35%)
scml4XP_002937206.1 DUF3588 95..205 CDD:288954
SAM_Scm 329..400 CDD:188977 23/65 (35%)
SAM 332..400 CDD:197735 23/64 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87386534
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.