DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbt and scml4

DIOPT Version :10

Sequence 1:NP_733209.1 Gene:l(3)mbt / 43288 FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_031758495.1 Gene:scml4 / 100490825 XenbaseID:XB-GENE-954903 Length:443 Species:Xenopus tropicalis


Alignment Length:64 Identity:23/64 - (35%)
Similarity:38/64 - (59%) Gaps:8/64 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1298 NPLHWTSWDVCEYIE----RAL-DSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKL 1356
            :|.:|:..||..:::    :|| ...|:.:   :.:|||.|||:|....:..||.||:|||:||
 Frog   371 DPSNWSVEDVVWFVKDADPQALGPHVDLFR---KHEIDGNALLLLRSDMVMKYLGLKLGPALKL 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 PRK10819 <332..>427 CDD:236768
MBT_L3MBTL1-like_rpt1 846..945 CDD:439091
MBT_L3MBTL1-like_rpt2 957..1045 CDD:439092
MBT_L3MBTL1-like_rpt3 1058..1130 CDD:439093
SAM_PNT 1278..1367 CDD:460486 23/64 (36%)
scml4XP_031758495.1 RBR 1..60 CDD:465382
SLED 135..245 CDD:463469
SAM_Scm 369..440 CDD:188977 23/64 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.