DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and phc1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_017945297.1 Gene:phc1 XenbaseID:XB-GENE-1013248 Length:852 Species:Xenopus tropicalis

Alignment Length:838 Identity:163/839 (19%)
Similarity:280/839 (33%) Gaps:230/839 (27%)


  Fly     1 MLPLSMASAEAKQL----QRNISLSMSPANGGVISPSTANCNGVASASGGNPN--PNSLLTLAPR 59
            ||...:::|:...|    |..|:.|...|     ||:|.:.....:..|...|  .:|...|..|
 Frog    57 MLQQQLSNAQLHSLAAVQQATIAASRQAA-----SPNTGSAQQTNTTQGSQANLSTSSSAQLLSR 116

  Fly    60 KEELRFLPLAPMGGNKTCNITISNV---------------QPMKSKLKSVNIVPNSIKSAGAGAT 109
            .:.:    .||.....|.::.:||.               ||....|..||      :|.|.|..
 Frog   117 TQNV----TAPSATTLTQSVLLSNASSPPLGQSQTQMYLRQPQLGNLLQVN------RSLGRGVP 171

  Fly   110 VGSADAPLFQLVPSPSNPSQPLVAILAPNRKTTLLGGGASNGQPVVIRSGTPLHKNSLTVETSNK 174
            :.|      ||             ||.||       |..:..|.|.......:|::|..|:  |.
 Frog   172 LNS------QL-------------ILMPN-------GSVAVQQEVTSPQNQGVHQDSDQVQ--NL 208

  Fly   175 PIQPGGSAAAAAVGGGTGGAPLTLVGKTVVPPKIQAATPVQIPS--------------------- 218
            .::...:||..:..|.|...|..|..|..:.|...|| |.||||                     
 Frog   209 AVRGQQTAATTSAAGATISQPAPLATKPQIHPASSAA-PTQIPSPNVPQSVKNPVGSTGGTVSQG 272

  Fly   219 ----------TGPGAQVSLLANPLK-----PRAPLILSKV--------AVDKLRLKFSQ---VKS 257
                      .|.|.|.|:..|..:     |...||.|..        .:.:.::.|.|   :..
 Frog   273 SQTESEGRKADGEGVQQSVGINLTRAATPAPNQTLISSATYTHIQPHSVLQQKQVVFQQQIAIHQ 337

  Fly   258 NPNALVLGKANHVKKLLTSPNPSGED--KTRSTQKN-----NKQNTSASQLKPVVAPKTAMPIAT 315
            :..:.:|..:.|::  |..|..:.:.  :|..||:.     ..|.||.|.: |..||   :||..
 Frog   338 HRQSQLLHASTHLQ--LAQPQAATQQGLQTPGTQQTLVVQPMLQATSESAI-PTKAP---VPIQP 396

  Fly   316 EVPTAD----NNKMSLIKSKPVAIKAVPLPSQEAPIVPA----------VAPVVTSPEKVDVKPT 366
            :.|...    |.:..|........:.:|:||...|.:|.          ...:.....:|..:.:
 Frog   397 KQPGKGVPPLNLQGHLGAKASQGTRPLPIPSPSQPHIPVQLVGARQQGPAQALALGATQVPSQAS 461

  Fly   367 AKPSIKTAPKPTPKP-----------------LEMSVNGPAKEKKAPAKEQKQKTM--------- 405
            :...:...|.|.|..                 |:..::||.|.|.....::...::         
 Frog   462 SMTQLTLPPSPAPVASVVAGAVQESQAGFYGVLQGKLSGPGKRKAEVEDDRDDPSVLPVKASPPT 526

  Fly   406 DKPPVVKEIAQHTPCG-PKELPKLKRSKSFVSNHPASPVANNERRHSVAIMAKEVDVIEQP---S 466
            |.||.|:|.:  ||.. |:...::..:.:.::......::.:.|:||   .:|....|.:|   :
 Frog   527 DAPPTVEETS--TPADKPEAATQVSPTLTVLAPTSVPALSISSRQHS---DSKPPQAIVKPQILT 586

  Fly   467 AAIETITIEDDDESEEEQQKPEIKKTPKQNQKPEKQEAPKKKQIPM----PILPAGITISTTSTA 527
            ..||...|::..|       |....:|:..::||||.|.....:|.    |..|.|.|.::.|.:
 Frog   587 HIIEGFVIQEGAE-------PFPVGSPQLLKEPEKQAASDTVLLPQAESPPPQPVGDTAASDSGS 644

  Fly   528 KK----------------KAVRKNSSVTTISSSSSDSSSYSDVEVVPTKKTEKELSMLPGISIIK 576
            .|                :..::..|:|.....:...|....::    :|..|||....|:...:
 Frog   645 SKLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLK----RKKLKELQEAGGVRARR 705

  Fly   577 AESLPLSREDFERSLRCDEQVPQTPPKSSSSSSSGSHASEMSPPPKLADPKPSSPPAKNAKKAND 641
            ..    .|.:.....|...|..:....||..|.:.|:....|       |...:||:......:.
 Frog   706 RG----PRRNSSEIARAKIQGKRMREDSSRGSDNSSYDEAFS-------PNSPAPPSCRTPHGDR 759

  Fly   642 HDANPSPSSKTNDFKKSMMQNLNMLKWRGQQPANLQNSTVRFELNE-FNFLQINERCQ 698
            ..:.|:.....:|.             .|..|..|.::..|:.:.| :.|:...:.||
 Frog   760 DGSTPTGGPSNSDL-------------LGINPMFLSSNPSRWSVEEVYEFISSLQGCQ 804

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
phc1XP_017945297.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.