DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and l3mbtl4

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_021325921.1 Gene:l3mbtl4 ZFINID:ZDB-GENE-110216-1 Length:413 Species:Danio rerio

Alignment Length:346 Identity:130/347 (37%)
Similarity:188/347 (54%) Gaps:38/347 (11%)


  Fly   804 QEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPIHLFLNPFPIS------PNCFEIGMKLEAID-- 860
            :|:.:..|:|:        |:::::         :.::|:..:      |:..:..:|.|::.  
Zfish    38 EEEEEDEQEDE--------EHVENR---------MVVSPYEAAPRLRGRPSLLKRDLKDESLKTL 85

  Fly   861 ------PENCSLFCVCSIV--EVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETARVLQA 917
                  ...|...|||::|  :|.|:||:|..||||..||||.||||.|:.|.|||:.|...|..
Zfish    86 VKRGRLTSRCVCVCVCAVVFLKVIGFRLRLHIDGYSECYDFWANADSPDLKPAGWCESTGHKLHP 150

  Fly   918 PKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATV 982
            ||.|....|.|.:||.....:|||:.||   ..|......:.|||||.|||.|..:...:|||::
Zfish   151 PKGYKPNEFEWEKYLEACNAQAAPKNLF---KTQSGASSESMFAVGMKLEAVDRKNPCLVCVASI 212

  Fly   983 TDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGWHEGRQQLIVPPDYQKSA--FIWDDYISEVG 1045
            .||:|.|..||||.|||.||.|...:||:|||.||.:...:.:..|....:.  |||:||:.:.|
Zfish   213 ADIVDSRFLVHFDNWDDTYDYWCDASSPHIHPVGWCQDHGRPLTAPQGHPNPEHFIWEDYMRDSG 277

  Fly  1046 GMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDD 1110
            ..||..|.|:......:|...|||.||:|||.|||.||:...:.:||::|.|.|..::.||::.|
Zfish   278 ASAAPAESFSEISAHGFQTLQKLEAVDRRNPMLIRVATITDTEDHRVKVHFDGWHEKFDFWVDSD 342

  Fly  1111 SPDLHPIGWCEATSHELETPP 1131
            .|||||:|||..|.|.||.||
Zfish   343 LPDLHPVGWCSRTGHPLEPPP 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 34/112 (30%)
MBT 929..1028 CDD:214723 41/99 (41%)
MBT 1038..1130 CDD:214723 41/92 (45%)
SAM_PNT 1279..1366 CDD:280377
l3mbtl4XP_021325921.1 MBT <107..151 CDD:308459 24/44 (55%)
MBT 162..258 CDD:214723 41/99 (41%)
MBT 270..362 CDD:214723 41/92 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.