DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and l3mbtl1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_002666454.2 Gene:l3mbtl1 ZFINID:ZDB-GENE-090313-102 Length:815 Species:Danio rerio

Alignment Length:884 Identity:248/885 (28%)
Similarity:359/885 (41%) Gaps:219/885 (25%)


  Fly   602 PKSSSSSSS--GSHASEMSPP-------PKLADPKPSSPPAKNAKKA---NDHDANPSPSSKTND 654
            |..||.|.:  .|.|..:.|.       |..|.|.|.....:||.||   ::.:|...|:.....
Zfish    17 PSESSVSHAPIDSSAHRLKPQDTTTIIFPASAHPLPKVELPQNAIKAIKGSELEATSLPAQVGGT 81

  Fly   655 FKKSMMQNLNMLKWR-------GQQ--------------------PANLQNSTVRFELNEFNFLQ 692
            .       :::|.|:       |..                    |.||.....:.:.....|.|
Zfish    82 I-------VHVLGWKEGMAILPGSNLKLCVSDTGALEVISEGKIGPTNLPTEGAQMKPANMEFKQ 139

  Fly   693 INERCQPRQG----PAAYFERPLYDRPGRR----PSACVHPLLYLCQRC--NFH-----GPAADF 742
            . |:.....|    |||:.|.   ||..|.    ..:.||      .||  |.|     |.....
Zfish   140 A-EKSDVSAGGNGRPAAFLEA---DRLHRARIEVQDSPVH------SRCGQNMHMTELRGEPMSE 194

  Fly   743 LAPHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKP----HKSLSAI 803
            :.........:.|......|...:|..:.:.             |.:..::.:|    .::|...
Zfish   195 IPAGLAEAQVMYREHDMMKPMKKRKRREYNS-------------PSEDDSDAEPMDEKSEALKID 246

  Fly   804 QEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPIHLF--LNPFPISPNCFEIGMKLEAIDPENCSL 866
            ..|::....:...:|:.|.:||:.: |.:|||:.||  ....|:..|.|..|||||.|||::.|:
Zfish   247 GRQIKTGSAETKLEPWSWPQYLELQ-KAIAAPVRLFQETQRVPLIRNSFRQGMKLEGIDPQHPSM 310

  Fly   867 FCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRY 931
            :.|.::.||.||||:|.|||||..:||||||:..||.|.|||:.||..|..||....|.||||.|
Zfish   311 YFVLTVAEVCGYRLRLHFDGYSDCHDFWVNANCADIHPAGWCESTAHKLHTPKGCKEEEFSWSNY 375

  Fly   932 LVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDG 996
            |..|..:|||:.|| ..:::.:.|.  ||.|||.|||.|..:...||||||||.:.:|..||||.
Zfish   376 LKITRSQAAPKELF-ISSVKPETDC--GFEVGMKLEAVDRMNPSLICVATVTDRVADRFLVHFDN 437

  Fly   997 WDDCYDLWVHITSPYIHPCGW-HEGRQQLIVPPDY-QKSAFIWDDYISEVGGMAASKELFTPRQP 1059
            |||.||.|...:||||||.|| ||....|..|.|| :...|.|:.|:.|.|..|.:.|.|..|..
Zfish   438 WDDTYDYWCDSSSPYIHPIGWCHERGLPLTPPQDYPEVDRFSWERYLEETGSTAVAAEAFRVRPA 502

  Fly  1060 MEYQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATS 1124
            ..:|.:||||.||:|.|.|||.|||.....||:::|.|.|...|..|::.|.||:||.||||:|.
Zfish   503 HSFQVQMKLEAVDKRCPGLIRVATVQEVDTYRIKIHFDGWSHLYDEWMDSDHPDIHPAGWCESTG 567

  Fly  1125 HELETPPGYLQPKSVMP-----------------------------------CDVEGCRGFGNAK 1154
            |.|:.||  .||....|                                   |...||.|.|:..
Zfish   568 HPLKPPP--CQPTVPKPGPRESLAVRQPSFSMSCKSLPQPRNTSKYSFHHRKCPTPGCDGSGHVT 630

  Fly  1155 -RFNLNVHALRECCPYAPENW--------------------------RQWRSKTVKPPRVAPENI 1192
             ||  ..|.....||.|..|.                          .::..:..:||:      
Zfish   631 GRF--TAHHCLSGCPLAERNQGRLKADLSDTEGSRRNLLVFGQRAKKSRYHGRIGRPPK------ 687

  Fly  1193 RRGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQMQKEEDAEQV 1257
               :.|..:|.|    |::..:.....:: ..|....::|..|.|.|:..|              
Zfish   688 ---YRKSQQRNC----QSMTSEGMYSSLF-MTAFTANSERTLSLCWEQHCK-------------- 730

  Fly  1258 PDERSLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTDIAK 1322
                               .||..      :......|.|    ||..:|..::...:...:.|:
Zfish   731 -------------------LLPGV------AGIHAGQVAT----WTIEEVFGFVNNLIGCEEQAR 766

  Fly  1323 VIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLIL 1361
            :..::.|||.:.|:|.:.::...:.:|:|||:|:::.||
Zfish   767 IFKDEMIDGESFLLLTQNDIVKIMNIKLGPALKIHNAIL 805

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 48/98 (49%)
MBT 929..1028 CDD:214723 50/100 (50%)
MBT 1038..1130 CDD:214723 41/92 (45%)
SAM_PNT 1279..1366 CDD:280377 19/84 (23%)
l3mbtl1XP_002666454.2 MBT 265..362 CDD:214723 48/98 (49%)
MBT 373..469 CDD:214723 49/99 (49%)
MBT 481..573 CDD:214723 41/92 (45%)
zf-C2HC 617..643 CDD:279824 9/28 (32%)
SAM 743..810 CDD:197735 18/68 (26%)
SAM_Scm-like-3MBT3,4 743..808 CDD:188981 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87041641
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T597284
orthoMCL 1 0.900 OOG5_130415
Panther 1 1.100 O PTHR12247
Phylome 1 0.910 0.745 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.