DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and phc2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001106410.2 Gene:phc2 XenbaseID:XB-GENE-996998 Length:804 Species:Xenopus tropicalis

Alignment Length:867 Identity:177/868 (20%)
Similarity:303/868 (35%) Gaps:231/868 (27%)


  Fly    91 LKSVNIVPNSIKSAGAGATVGSADAPLFQLVPSPSNPSQPLVAILAP----NRKTTLLGGGASNG 151
            |:.|.:......||.| |||....:|....:.||.:.|:|..:..||    .::..|||...|  
 Frog    84 LQQVGLATGRPGSAPA-ATVPQQSSPHSPGINSPQSISRPQSSTPAPPSAITQQAVLLGSATS-- 145

  Fly   152 QPVVIRSGTPLH-KNSLTVETSNKPIQPGGSAAAAAVGGGTGGAPLTLVGKTVVPPKIQAATPVQ 215
             |.:..|...:: :..:.:.|....:....|..:|       |||         ||    |...|
 Frog   146 -PALSASQAQMYLRAQMLIFTPTATVTSVQSEVSA-------GAP---------PP----AGSTQ 189

  Fly   216 IPSTGPGAQVSLLANPLKPRA--PLILSKVAVDKLRLKFSQVKSNP--NALVLGKANHVKKLLTS 276
            :||....||.|    .|.|::  |.:..|.|       .|.:.:.|  ||.......|:  ||.|
 Frog   190 VPSVAVRAQHS----GLSPQSHLPSLARKPA-------SSTLSAQPVANAAQTKATGHL--LLPS 241

  Fly   277 --------PNPSGEDKTRSTQKNNKQNTSASQLKPVVAPKTAMPIATEVPTADNNKMSLIKSKPV 333
                    |:..||    |...:.:..||...:.||.|.....|..|......|:|.  |:....
 Frog   242 IPGAHLEPPDRKGE----SRAADGRGATSCRTVAPVTAHSIIAPAHTHPLIQQNHKQ--IQQHQF 300

  Fly   334 AIK---AVPLPSQEAPIVP----------AVAPVVTSPEKVDVKPTAKPSIKTAPKPTPKPLEMS 385
            .|:   |:|||...||:.|          ..:|.|||..::....|..|.:.:||          
 Frog   301 VIQPRAALPLPQLGAPLQPFTHQPQLCQSLTSPPVTSQAQLGPPSTCAPQLHSAP---------- 355

  Fly   386 VNGPAKEKKAPAKEQKQKTMDKPPVVKEIAQHTPCGPKELPK-LKRSKSFVSNHPASPVANN--- 446
             .||  .|.:|..::::.......|:.::  |:|.|....|: :...::|      :|:.|:   
 Frog   356 -GGP--PKISPEGQERRLLPHSSTVILQL--HSPPGTTPTPQDVSHKRTF------TPLGNSPCL 409

  Fly   447 -ERRHSVAIMAKEVDVIEQPSAAIETITIEDDDESEEEQQKPEIKKTPKQNQKPEKQEAPKKKQI 510
             ......|.:|:|    ..|..|..|.|      |:..|.:|               :.|:...:
 Frog   410 LHLHPPTAPLAQE----SAPGGASVTET------SDLCQCQP---------------DDPRPPAL 449

  Fly   511 PMPILPAGITISTTSTAKKKAVRKNSSVTTISSSSSDSSSYSDVEVVPTKKTEKELSMLPGISII 575
            |.|.:|:.:.:::.:.:...     .:|.|.:|:.:..:......|.|...|.    ::.|..|.
 Frog   450 PDPTIPSALDMTSGNGSAPV-----PTVATGNSAQNGENKPPQAVVRPQILTH----VIEGFVIQ 505

  Fly   576 K-AESLPLSRE----DFERS---LRCDEQVPQ-----TPPKSSSSSSSGSHASEMSPP--PKLAD 625
            : |:..|..|.    :..||   :...|:.||     ..|:..|::::.:..|||...  |...|
 Frog   506 EGAQPFPSHRSRAAPEVGRSSLLIGAHERYPQGLLAEKVPQQDSNTTTTTTDSEMEETFVPGFPD 570

  Fly   626 PK-PSSPPAKNAKKAN--DHDANPSPSSKTNDFKKSMMQNLNMLKWRG---------QQPANLQN 678
            .| ...||....:...  |.:.....|.:......:...|:...|..|         |:|...::
 Frog   571 SKGDGDPPKLKCELCGRVDFEYKFKRSKRFCSMACAKRYNVGCTKRVGLFHPDRSKLQKPTGAKH 635

  Fly   679 STVRFELNEFNFLQINERCQ-PRQGPAAYFERPLYDRPGRRPSACVHPLLYL-CQRCNFHGPAAD 741
            :..|.:......:..:.:.| |...|      |:...|...|||..|..... ..||:.:....:
 Frog   636 ARRRAQKGPLQSVSTDPKKQVPASAP------PIAPGPVPAPSALKHSNSQEDSSRCSDNSSYEE 694

  Fly   742 FLAPHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQEQ 806
            .|:|...|                   |.:||.:.|:.....|.|      :.:.|.:|:     
 Frog   695 PLSPLSAS-------------------SSLSRPRPERNLEAPPPL------HSRDHIALN----- 729

  Fly   807 LQQRQKDKPRKPFRWS-----EYLKSKGKDVAAPIHLFLNPFPISPNCFEIGMKLEAIDPENCSL 866
                |...|..|.:|:     |:::|                  .|.|.:|..:..|.:.:..:|
 Frog   730 ----QDFLPSNPTKWNVEDVYEFIRS------------------LPGCQDISEEFRAQEIDGQAL 772

  Fly   867 FC-----VCSIVEVR-GYRLKL 882
            ..     :.|.:.:: |..|||
 Frog   773 LLLKEDHLMSAMNIKLGPALKL 794

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 12/73 (16%)
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
phc2NP_001106410.2 PHC2_SAM_assoc 610..734 CDD:293222 29/164 (18%)
SAM_Ph1,2,3 735..803 CDD:188976 14/79 (18%)
SAM 737..804 CDD:197735 14/77 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87319033
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.