DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and sfmbt1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_005155896.2 Gene:sfmbt1 ZFINID:ZDB-GENE-030131-2592 Length:868 Species:Danio rerio

Alignment Length:910 Identity:170/911 (19%)
Similarity:281/911 (31%) Gaps:378/911 (41%)


  Fly   799 SLSAIQEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPIHLF----------LNPFPISPNCFEIG 853
            ||.|::......|   ....|.|.:||:..|. ::.|.|.|          |.|          |
Zfish     2 SLEALESDADSGQ---DVSEFNWDDYLEESGA-LSVPHHAFKHVDQGLETGLTP----------G 52

  Fly   854 MKLE-AIDPENCSLFCVCSIVEVRGYRLKLSFDGYSS--MYDFWVNADSQDIFPPGWCDETARVL 915
            |||| .:..|:.|::.|.:|:...|..|.|.::||..  ..|||.:..:.|:.|.||..:..|::
Zfish    53 MKLEVCVRTESESVYWVATIITTCGQLLLLRYEGYQDDRRADFWCDIMTADLHPIGWSKQQGRMM 117

  Fly   916 QAPKDYNSERFSWSRYLVKTGGK--AAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKIC 978
            :.|:....:...|...|.|...:  :.|.:|..  ..|:..:..:..:.|:::|..|..|.|.:.
Zfish   118 KPPEGVREKHQDWEALLEKALAESCSVPASLLE--GAQRGCNPIDLLSPGLNVELVDHQDAGVVW 180

  Fly   979 VATVTDILDERIRVHFDGWDDCYD----LWVHITSPYIHPCGW---------------------- 1017
            .|.:.:.:..|:|:.:.|.|...:    .||....|.:|..||                      
Zfish   181 SAVIEENIGGRLRLRYAGTDGLPENQSITWVFYLDPLLHLSGWAQEHNCTLRPPAALLPLRTEAE 245

  Fly  1018 ------------------------------H---EGRQ--------------------------- 1022
                                          |   ||.:                           
Zfish   246 WEEVKKSISSQEQDPSISEEFYRDRSAITPHCFTEGMKLEAVDPAAPFTISPATVAKVFNEQFFL 310

  Fly  1023 ---------------------------------------QLIVPPDYQKSAFIWDDYISEVGGMA 1048
                                                   :|..||.:|...|.|.||:.:....|
Zfish   311 VLMDDMRDEAQKEGGAHSFLCHRDSPGIFPTQWSLKNGVKLSPPPGFQGQDFDWADYLKQCEAEA 375

  Fly  1049 ASKELFTPRQPME--YQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLD----CWPTEYYFWL 1107
            |.::.|.| .|.:  .:|.|.||.|:...|..|..|||...||..:.:.|:    ..|.   ..:
Zfish   376 APQQCFPP-DPSDQCIKESMMLEAVNPICPENIHVATVTKVKGQHMWIRLEGLKQAMPE---IIV 436

  Fly  1108 EDDSPDLHPIGWCEATSHELETP----------PGYLQP-------KSVMP-------------- 1141
            ..||.|:.|:.|||...:.|..|          ...:||       |...|              
Zfish   437 HTDSMDIFPVSWCETNGYPLLHPCKPRVEKQRKVAVVQPEKHRVPSKDSSPDTTKQHMNSSQAEM 501

  Fly  1142 ------------------------------CDVEGCRGFGN------------------------ 1152
                                          .::..|.|.||                        
Zfish   502 AGQANGKYCCPKIYFNHRCFSGPYLNKGRIAELPQCVGPGNCVLVLKEVLTLLINSAYKPSRVLR 566

  Fly  1153 ----------------------AKRFNLNVHALR----------------ECCP--YAP------ 1171
                                  .|.:...|..:|                ||||  :.|      
Zfish   567 ELQLDQEGRWQGHGETLKAKYKGKSYRATVEIVRTADQVADFCRKTCIKLECCPNLFGPRMVLER 631

  Fly  1172 --EN------------WRQWRSKTVKPPRVAPENI-----RRGWAKK--------TKRACS---- 1205
              ||            :.:.:|:.|..|.....|:     |||..:|        .||..|    
Zfish   632 CSENCSVLTKTKYTYYYGKKKSRRVGRPPGGHSNLEGGVKRRGRRRKRRKQLFVHKKRRSSASVD 696

  Fly  1206 ----------------EAKQAIKEDSQQEIVYPKVAEVVQAKRKT-----SPCEEKVVKKQKQMQ 1249
                            :...::.||:..|:....:.:...:::|:     ||...:..:..::.:
Zfish   697 NTPAGSPQGSGDEEDLDEDDSLSEDTGSEMQDELMDDSEYSEKKSQPPTPSPSPPETPRPTRRRR 761

  Fly  1250 K------EEDAEQVPDERSLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPLHWTSWDVC 1308
            |      .:|..:.|..:|   .|:.|    ||.|               .:.::||.|:..||.
Zfish   762 KARSPSCSDDENRPPSPKS---PRTEV----PQKL---------------CLESSPLEWSVTDVV 804

  Fly  1309 EYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLRIAVVCKFDS 1373
            .:| |..|...:|::..:|:|||:|||:|....:...:.||:|||:||...|..:::|...:|.|
Zfish   805 RFI-RTTDCAPLARIFMDQEIDGQALLLLNLPTVQECMDLKLGPAIKLCHHIERVKLAFYQQFAS 868

  Fly  1374  1373
            Zfish   869  868

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 30/109 (28%)
MBT 929..1028 CDD:214723 26/226 (12%)
MBT 1038..1130 CDD:214723 29/98 (30%)
SAM_PNT 1279..1366 CDD:280377 25/87 (29%)
sfmbt1XP_005155896.2 MBT 22..120 CDD:214723 30/109 (28%)
MBT 153..234 CDD:327428 17/81 (21%)
MBT 255..354 CDD:214723 4/99 (4%)
MBT 366..456 CDD:214723 28/94 (30%)
SLED 511..626 CDD:314933 12/115 (10%)
SAM_Scm-like-4MBT1,2 784..868 CDD:188980 31/104 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87282480
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.