DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17991 and CG16781

Sequence 1:NP_651547.1 Gene:CG17991 FlyBaseID:FBgn0039498 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001259211.1 Gene:CG16781 FlyBaseID:FBgn0029661 Length:386 Species:Drosophila melanogaster

Alignment Length:316 Identity:116/317 (37%)
Similarity:166/317 (52%) Gaps:62/317 (20%)


  Fly    20 ERCCWICFETDKEAGRQAWVNPCLCRGTNKWVHQSCISLWIDEKTRINNNLQAVSCPQCQTEYTI 84
            ||.|||||.|.::.....||.||.|||..|||||||:..||||| ::.:..|.|.|.||||||.:
  Fly    41 ERICWICFATSEDNPHAHWVQPCQCRGDTKWVHQSCLYRWIDEK-QLGDRRQTVICQQCQTEYIM 104

  Fly    85 AYPNLWIFDRALE--------LTNDLILTNLYNCLANVFTVVFAYWSAVSFGAKTYLQITGQEGH 141
            .:|.:....|.||        :...|:|.....|:         ||.|:::||.|.:|:.||: .
  Fly   105 VFPQMNPIARVLEKLDYAVRRICPFLVLGMFLCCI---------YWIALTYGAFTIIQVVGQD-R 159

  Fly   142 VHQIIQSGDLLVVLVGFPLISVVLILGRLIPWEDALLRFIRICYSLLRSLSMMCLGRK--YDHQT 204
            ..|:::  :.:::|||.|.|.|.|||.||:.|:||:|:.:|..|        :.:.||  :.|:|
  Fly   160 AMQLME--NKVILLVGLPFIPVGLILFRLVRWKDAVLKAMRSIY--------IYIPRKLPFFHRT 214

  Fly   205 E-----------------------------PYPSAP-MTE-YSASRVVCGAILLPTISMYVGRVL 238
            .                             |....| :|| :..||::|||..|||.:..||.|.
  Fly   215 NQSEGASRDLGDLGDLDDLSVSSSSSISLPPIQHNPSITEPFYISRLICGAFFLPTFATTVGNVF 279

  Fly   239 YSSVDDRLQQTLLGGLTFIAIKGFLKMYLMHSQYICRMKRRVLDYTKENLAEADGH 294
            :..:||.||:|:|||:.:|.|||.|||||....|:.|:.|.:|:||.||:...|.|
  Fly   280 FGRLDDALQRTILGGIAYIGIKGLLKMYLDQKLYLRRLGRCILNYTDENVRMIDQH 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17991NP_651547.1 RINGv 22..79 CDD:128983 30/57 (53%)
CG16781NP_001259211.1 RINGv 43..99 CDD:128983 30/57 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C222072088
eggNOG 1 0.900 E1_KOG3053
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6573
OrthoDB 1 1.010 D426217at33208
OrthoFinder 1 1.000 FOG0002125
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46283
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.