DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17991 and SPBC32F12.07c

Sequence 1:NP_651547.1 Gene:CG17991 FlyBaseID:FBgn0039498 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_596150.1 Gene:SPBC32F12.07c PomBaseID:SPBC32F12.07c Length:340 Species:Schizosaccharomyces pombe

Alignment Length:375 Identity:78/376 (21%)
Similarity:126/376 (34%) Gaps:152/376 (40%)


  Fly    15 DSTELERC---CWICFET-DKE---AGRQAWVNPCLCRGTNKWVHQSCISLWIDEKTRINNNLQA 72
            |:.:.|:.   ||||:|. ||:   ....:|..||.|   :...|:||:..:|   ||..    :
pombe     3 DTAKYEKSSARCWICYEEYDKKLCSLSNDSWRRPCRC---SLIAHESCLISYI---TRSG----S 57

  Fly    73 VSCPQCQTEYTIAYP--------NLWIFDRALELTNDLILTNLYNCLANVFTVVFAYWSAVSFGA 129
            ..||||.|.|.||.|        |:.....:||                      |..:.|:||.
pombe    58 TRCPQCLTAYRIAKPPKEKSWAVNVLGIGHSLE----------------------AGLAQVTFGV 100

  Fly   130 KTYLQITGQEGHVHQII-QSG----------DLLVVLVGFPLISVVLILGRLIPWEDALLRFIR- 182
            .:.|.||   ..::.|. |:|          ..|:.::..|:.|.|::  .|:|.  .|:||.. 
pombe   101 GSCLGIT---KFIYSIFKQTGIWICKQVADESSLIEMLKKPVFSSVVL--PLLPC--MLVRFYEA 158

  Fly   183 ----ICYSL-------------------------LRSLSMMCLGRKYD----------------- 201
                |.:||                         :|||....:.|.:|                 
pombe   159 PPYDIAFSLYTHFSIYSCAEKISNTSLLLCTLPWVRSLYKELMTRIFDGIVIGADGEFEDSETDW 223

  Fly   202 -----------HQTEPYPSAPMTE------------------YSASRVVCGAILLPTISMYVGRV 237
                       :|.|.......||                  ....|:|...:|.|....::||.
pombe   224 FRQFEAQVEHRNQVEDVNEREDTESEFWILLSVAHVFLDAFTTKILRIVRPILLFPLAGKFLGRF 288

  Fly   238 LYSSVDDRLQQTLLGGLTFIAIKGFLKMYLMHSQYICRMKR-----RVLD 282
            :..:. .:|:::::|....:..|... :|    .:|...||     |:||
pombe   289 IPGNF-TKLEKSIIGAFAALVFKDIF-VY----GFIAWRKRKPWSIRILD 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17991NP_651547.1 RINGv 22..79 CDD:128983 21/64 (33%)
SPBC32F12.07cNP_596150.1 RING 14..63 CDD:302633 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002125
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130920
Panther 1 1.100 O PTHR46283
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.