DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17991 and M110.3

Sequence 1:NP_651547.1 Gene:CG17991 FlyBaseID:FBgn0039498 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_495728.1 Gene:M110.3 WormBaseID:WBGene00010913 Length:189 Species:Caenorhabditis elegans

Alignment Length:146 Identity:44/147 (30%)
Similarity:63/147 (43%) Gaps:39/147 (27%)


  Fly    14 GDSTELERCCWICFETDKEAGRQAWVNPCLCRGTNKWVHQSCISLWIDEKTRINNNLQAVSCPQC 78
            |:..|.|:.|..||.|:.: ...::|:||.|||:..|||..|:::|..:.    |.:|.|.|.||
 Worm     7 GNEQETEKYCKFCFGTESD-NALSFVHPCRCRGSIHWVHHQCLAMWFSKA----NAVQQVMCIQC 66

  Fly    79 QTEY----TIAYPNLWIFDR-------ALELTNDLILTNLYNCLANVFTVVFAYWSAVS--FGAK 130
            ||.|    |:.....|...|       .||:|.||.:|                |..||  .|  
 Worm    67 QTRYQKQLTLKSWKSWTIPRFGIDKFGLLEITVDLWIT----------------WRTVSGFVG-- 113

  Fly   131 TYLQITGQEGHVHQII 146
               .:.|.:|...:||
 Worm   114 ---MMNGTKGIFREII 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17991NP_651547.1 RINGv 22..79 CDD:128983 21/57 (37%)
M110.3NP_495728.1 RINGv 15..67 CDD:128983 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C222072232
eggNOG 1 0.900 E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D426217at33208
OrthoFinder 1 1.000 FOG0002125
OrthoInspector 1 1.000 T375247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46283
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.810

Return to query results.
Submit another query.