DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17991 and march5

Sequence 1:NP_651547.1 Gene:CG17991 FlyBaseID:FBgn0039498 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001116950.1 Gene:march5 XenbaseID:XB-GENE-946356 Length:283 Species:Xenopus tropicalis

Alignment Length:283 Identity:113/284 (40%)
Similarity:173/284 (61%) Gaps:14/284 (5%)


  Fly     2 ASNVAAPQASAGGDSTELERCCWICFETDKEAGRQAWVNPCLCRGTNKWVHQSCISLWIDEKTRI 66
            |::|:..|.        |:|.||:||.||::.....||.||.|||:.|||||:|:..|:|||.| 
 Frog     4 ANSVSVQQM--------LDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQR- 59

  Fly    67 NNNLQAVSCPQCQTEYTIAYPNLWIFDRALELTNDLILTNLYNCLANVFTVVFAYWSAVSFGAKT 131
            .|:...|:||||..||.|.:|||......|:|.:.||........|.:. |...||:||::||.|
 Frog    60 GNSTARVACPQCNAEYLIVFPNLGPVVYVLDLADRLISKACPFAAAGIM-VGSIYWTAVTYGAVT 123

  Fly   132 YLQITG-QEGHVHQIIQSGDLLVVLVGFPLISVVLILGRLIPWEDALLRFIRICYSLLRSLSMMC 195
            .:|:.| :||  ..:::..|.|.:|:|.|.|.||||||::|.|||.:||..|...:.|:.|:.:.
 Frog   124 VMQVVGHKEG--LDVMERADPLFLLIGLPTIPVVLILGKMIRWEDYVLRLWRKYSNKLQILNSIF 186

  Fly   196 LGRKYDHQTEPYPSAPMTEY-SASRVVCGAILLPTISMYVGRVLYSSVDDRLQQTLLGGLTFIAI 259
            .|........|..:.|:.:: ||:|::|||::.|||:..||::::|:|:..||:|:|||:.|:||
 Frog   187 PGIGCPVPRVPAEANPLADHVSATRILCGALVFPTIATIVGKLMFSTVNSNLQRTILGGIAFVAI 251

  Fly   260 KGFLKMYLMHSQYICRMKRRVLD 282
            ||..|:|....||:.:..|::||
 Frog   252 KGAFKVYFKQQQYLRQAHRKILD 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17991NP_651547.1 RINGv 22..79 CDD:128983 30/57 (53%)
march5NP_001116950.1 RINGv 17..72 CDD:128983 30/56 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C222083049
eggNOG 1 0.900 E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D426217at33208
OrthoFinder 1 1.000 FOG0002125
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.