DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNApol-alpha73 and Pola2

Sequence 1:NP_733206.3 Gene:DNApol-alpha73 FlyBaseID:FBgn0005696 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_445932.2 Gene:Pola2 RGDID:621817 Length:600 Species:Rattus norvegicus

Alignment Length:645 Identity:192/646 (30%)
Similarity:304/646 (47%) Gaps:88/646 (14%)


  Fly     3 EELKQQFDEMGVEPADAVLGRCAELAITYNIHDATE--FVEQWMAFSLSH----LQGEDPAIENL 61
            ::|.::....|::..|::|.:.|||...|.   .||  .|.:.:||..|.    |.|     |.|
  Rat     6 QQLAEELQIFGLDCEDSLLEKLAELCTLYR---QTEERMVSELIAFCTSAGKSCLTG-----EIL 62

  Fly    62 GDFERKVLQLRKDKAGYKAT--GQKAKSYGSPSVQDTSSLATYGVMEDDPMLDDYVSESAVD--- 121
            ..||.:||..:..||.:.|:  .:.|.:....|:|:......    |::.:|..|.:.|...   
  Rat    63 SSFEHEVLNKKLSKACHSASKDNRHAGARDIVSIQELIEAEE----EEETLLSAYTTPSKGPHKR 123

  Fly   122 -SSALHTPKAKKQ-SDRTANLKGAALFSPASYTPQSAKRKAGLETPSNSVAGKP--GDIVDTFGH 182
             ||...||..|:. |.|:.:    .|.||:|::|.:        |||...:.:.  |::|.|||.
  Rat   124 VSSTPETPLTKRSISTRSPH----QLLSPSSFSPSA--------TPSQKYSSRTNRGEVVTTFGS 176

  Fly   183 PKLLAGSSWQSQMEHTVPVTQKLLHNDAPLTIANLGYMNDLLTDRCHNLRVRFNQTGPALVDKKL 247
            .:   |.|| |....:..::.|::....||| ::...|...|.|....|..:..:.|..|  |:.
  Rat   177 AQ---GVSW-SGRGGSGSISLKVMGYPEPLT-SSYKTMFQQLPDIREVLTCKIEELGSEL--KEH 234

  Fly   248 GQAGAAECIWYPQDRQVLQSAGGLHAVGMIHSEDDGPLDAHSAFMAVLDDDVEDEMDPTLTLNFS 312
            .:..|...:..|....|:       .:|.|..:.:|.|::.|   .:|:.|.|......:.::.|
  Rat   235 YKIEAFTPLLVPAQEPVI-------LLGQIGCDSNGRLNSKS---VILEGDREHSSGAQIPVDMS 289

  Fly   313 RVKSASIFPGQVVLAKGFIPRGKTFMVEEIHTERKLTPATPLQI----DRELQF-----VVASGP 368
            .:|..|:||||||:.:||...|:..      |..||....||..    :.|..|     :||.||
  Rat   290 ELKDYSLFPGQVVIMEGFNTTGRRL------TATKLYEGVPLPFYQPTEEEGDFEQTMVLVACGP 348

  Fly   369 FTDSTDLFYEPLHDLLKYLKDHRPDVLVLTGPFLDADHKMVG--ELAETFDTFFEKMIGGIME-- 429
            :|.|..:.|:||.||:..:...|.||.:|.||||||.|:.|.  :|...|:..|::.:..::|  
  Rat   349 YTTSDSITYDPLLDLISTINHDRLDVCILFGPFLDAKHEQVENCKLTSPFEDIFKQCLRTVIEGT 413

  Fly   430 -SIGSHTAVLVVTSQKDAMALSVYPTPPPAL----RRTYPNLYMLPDPSLVDLDGFTLGVTSTDV 489
             |.|||  ::.|.|.:|.....|||.||...    |.....:..:.:|..:.::|...|:||||:
  Rat   414 RSSGSH--LVFVPSLRDVHHEPVYPQPPFTFSELPREDKKRVQFVSEPCNLSINGVMFGLTSTDL 476

  Fly   490 VDHLLSHEFAVNAG--ERMHRAINHLFHQGSFYPLYPPADEDMAYDSQLALKYAQLKQLPNVLIL 552
            :.|:.:.|...::|  :|..|.:.|:..|.|:|||||| .||||.|.:....||||...|:|.|:
  Rat   477 LFHIGAEEICSSSGTSDRFSRILKHILTQRSYYPLYPP-HEDMAIDYENFYTYAQLPVTPDVFIV 540

  Fly   553 PSDQRHFIRLVNDCLVINPGRVA-DKKGGTFARFLV--APSVPGKAANMFNSVACQVQRI 609
            ||:.|:|::.:..|:.:||||:. .:.||||.|..:  .|...........|||.||.||
  Rat   541 PSELRYFVKDIFGCVCMNPGRLTKGQVGGTFGRLYLRRQPKGTDSEGRQGLSVAAQVVRI 600

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNApol-alpha73NP_733206.3 Pol_alpha_B_N 18..>180 CDD:285602 48/177 (27%)
DNA_pol_E_B 363..561 CDD:281968 77/209 (37%)
Pola2NP_445932.2 Pol_alpha_B_N 20..238 CDD:285602 65/249 (26%)
DNA_pol_E_B 343..549 CDD:281968 77/209 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238488881
eggNOG 1 0.900 E1_COG5214
Hieranoid 1 1.000
Homologene 1 1.000 H48121
Inparanoid 1 1.050 205 1.000 Inparanoid score I3609
OMA 1 1.010
OrthoDB 1 1.010 D239034at33208
OrthoFinder 1 1.000 FOG0004201
OrthoInspector 1 1.000 T1087402
orthoMCL 1 0.900 OOG5_128793
Panther 1 1.100 LDO PTHR23061
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.