DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNApol-alpha73 and POL12

Sequence 1:NP_733206.3 Gene:DNApol-alpha73 FlyBaseID:FBgn0005696 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_009518.1 Gene:POL12 SGDID:S000000131 Length:705 Species:Saccharomyces cerevisiae

Alignment Length:687 Identity:158/688 (23%)
Similarity:268/688 (39%) Gaps:198/688 (29%)


  Fly    42 QWMAFSLSHLQGE-DPAIENLGDFERKVLQLRKDKAGYK-------------------------- 79
            :|..||....|.. |...:|:.:| ::.|||:.:|...:                          
Yeast    41 KWEQFSNQRRQTHTDLTSKNIDEF-KQFLQLQMEKRANQISSSSKVNTSTKKPVIKKSLNSSPLF 104

  Fly    80 -------ATGQKAKSYGSPSVQDTSSLATYGV---------------MEDDP-MLDDYVSESAVD 121
                   .|.:|.|.:|..|:.|  |..||.|               :|..| |.:|.|.:||..
Yeast   105 GLSIPKTPTLKKRKLHGPFSLSD--SKQTYNVGSEAETNEKGNSSLKLEFTPGMAEDAVGDSAPL 167

  Fly   122 SSALHTPKAKKQSDRTANLKGAALF-SPASYTPQSAKRKAGLETPSNSVAG--KPGDIVDTFGHP 183
            |.|       |.||  |...|::.| :|.:.||.::::    ..|:..:..  .|.:|..:.|:|
Yeast   168 SHA-------KSSD--AKTPGSSTFQTPTTNTPTTSRQ----NVPAGEILDSLNPENIEISSGNP 219

  Fly   184 K--LLAGSSWQSQMEHTVPVTQKLLHNDA---PLTIA----------NLGYMNDLLTDRCHNL-R 232
            .  ||:              |::..:|..   |...|          ||...:|:|.|:..:. :
Yeast   220 NVGLLS--------------TEEPSYNQVKVEPFYDAKKYKFRTMRQNLQEASDVLDDQIESFTK 270

  Fly   233 VRFNQTGPALVDKKLGQAGAAECIWYPQDRQVLQSAGGLHAVGMIHSEDDGPLDAHSAFM----A 293
            :..|.       .||.....|:        ..:||...::|||.|  ..|.|  .:..|:    .
Yeast   271 IIQNH-------YKLSPNDFAD--------PTIQSQSEIYAVGRI--VPDSP--TYDKFLNPESL 316

  Fly   294 VLDDDVEDEMDPTLTLNFSRVKSASIFPGQVVLAKGFIPRGKTFMVEEIHTERKLT---PATPLQ 355
            .|:......:...:.|:.|:|...|.|.||:|..||....|..|.|..|     |.   |.:|:.
Yeast   317 SLETSRMGGVGRRVRLDLSQVNELSFFLGQIVAFKGKNANGDYFTVNSI-----LPLPYPNSPVS 376

  Fly   356 IDRELQ------------FVVASGPFTDSTDLFYEPLHDLLKYLKDH-RPDVLVLTGPFLDADHK 407
            ..:|||            .:|..||:..:.:...|.|.:.:..:.:. :|.||::.|||:|..|.
Yeast   377 TSQELQEFQANLEGSSLKVIVTCGPYFANDNFSLELLQEFIDSINNEVKPHVLIMFGPFIDITHP 441

  Fly   408 MV--GEL---------AETFDTFFEKMIGGIMESIGSHTAVLVVTSQKDAMA-LSVYPTPP---P 457
            ::  |:|         .:|.|..|.|:...|:::|..|...:::.|.|||:: .:.||...   .
Yeast   442 LIASGKLPNFPQFKTQPKTLDELFLKLFTPILKTISPHIQTVLIPSTKDAISNHAAYPQASLIRK 506

  Fly   458 ALRRTYPNLYMLPDPSLVDLDGFTLGVTSTDVVDHLLSHEFAVNAGE-----RMHRAINHLFHQG 517
            ||:....|...:.:||...::....|.::.|....|   :..:..|.     |:.|...|:..|.
Yeast   507 ALQLPKRNFKCMANPSSFQINEIYFGCSNVDTFKDL---KEVIKGGTTSSRYRLDRVSEHILQQR 568

  Fly   518 SFYPLYP--------PAD-------------EDMAYD----SQLALKYAQLKQL-----PNVLIL 552
            .:||::|        |.|             |:..|:    :.|.:.|..|.:.     |:::|:
Yeast   569 RYYPIFPGSIRTRIKPKDVSTKKETNDMESKEEKVYEHISGADLDVSYLGLTEFVGGFSPDIMII 633

  Fly   553 PSDQRHFIRLVNDCLVINPGRVADKKG--GTFARFLV 587
            ||:.:||.|:|.:.:||||||.....|  |::|:..|
Yeast   634 PSELQHFARVVQNVVVINPGRFIRATGNRGSYAQITV 670

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNApol-alpha73NP_733206.3 Pol_alpha_B_N 18..>180 CDD:285602 42/191 (22%)
DNA_pol_E_B 363..561 CDD:281968 57/249 (23%)
POL12NP_009518.1 POL12 9..705 CDD:227539 158/688 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238501091
eggNOG 1 0.900 E1_COG5214
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3706
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004201
OrthoInspector 1 1.000 T1136222
orthoMCL 1 0.900 OOG5_128793
Panther 1 1.100 LDO PTHR23061
Phylome 1 0.910 0.964 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R342
TreeFam 1 0.960
1110.680

Return to query results.
Submit another query.