DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNApol-alpha73 and pola2

Sequence 1:NP_733206.3 Gene:DNApol-alpha73 FlyBaseID:FBgn0005696 Length:609 Species:Drosophila melanogaster
Sequence 2:XP_012816322.1 Gene:pola2 XenbaseID:XB-GENE-5916783 Length:642 Species:Xenopus tropicalis

Alignment Length:650 Identity:185/650 (28%)
Similarity:302/650 (46%) Gaps:101/650 (16%)


  Fly     1 MEEEL---KQQFDEMGVEPADAVLGRCAELAITYNIHDATEFVEQWMAFSLSHLQGEDPAIENLG 62
            :||||   ...|::      |.|..:..||...:.:.: .:.|.:|||||.:  :.....:.||.
 Frog    53 IEEELTVFDVNFED------DEVPEKMVELCTVHRLQE-EDMVNEWMAFSTT--RNLPLTVSNLN 108

  Fly    63 DFERKVLQLRKDKAGYKATGQKAKSYGS---PSVQDTSSLATYGVMEDDPMLDDYVSES-AVDSS 123
            ..|.:|  |.|..|..:.:.:|.|..|:   .::|:...:.|    |::.:||.|.:.: .....
 Frog   109 ILEHEV--LNKKSARPRPSQKKEKHCGNRDFNTIQELIEVET----EEENLLDSYATPAKGSQKR 167

  Fly   124 ALHTPKAKKQSDRTANLKGAALFSPASYTPQSAKRKAGLETPSNSVAGKP--GDIVDTFGHPKLL 186
            .|.||:..:....:.|.....||||||::|.:        |||.....:.  |::|.|:|.   |
 Frog   168 NLSTPEHPQSKRISVNRSPHVLFSPASFSPSA--------TPSQKYGSRTNRGEVVTTYGE---L 221

  Fly   187 AGSSWQSQMEHTVPVTQKLLHNDAPLTIANLGYMNDLLTDRCHNLRVRFNQTGPALVDKKLGQAG 251
            .|::|.........| :.....|.|||     .|...:..:..::|        .:|..|:.:.|
 Frog   222 QGTTWNGGSGRNTSV-ELFTCQDEPLT-----KMYKFMFQKLMDIR--------EVVSSKIEELG 272

  Fly   252 AA----------ECIWYPQDRQVLQSAGGLHAVGMIHSEDDGPLDAHSAFMAVLDDDVEDEMDPT 306
            |:          ..:.:|....|.       .:|.|..:.:|.|::.|   .:|:.|.|......
 Frog   273 ASLKNHFQIDEFTSVSFPAQETVT-------VLGQIGCDSNGKLNSKS---VILEGDREHSAGMQ 327

  Fly   307 LTLNFSRVKSASIFPGQVVLAKGFIPRGKTFMVEEIHTERKLTPATPL---QIDRELQ------F 362
            :.::.|.:|..|:||||||:.:|....|:.|:      ..||....||   |..:|.:      .
 Frog   328 VPVDLSELKEYSLFPGQVVIMEGTNSTGRRFV------PTKLYEGVPLPFHQPSKEFEECPQQMV 386

  Fly   363 VVASGPFTDSTDLFYEPLHDLLKYLKDHRPDVLVLTGPFLDADHKMVG--ELAETFDTFFEKMIG 425
            :.|.||||.|..:.|:.|.||:..|....||:.:|.||||||.|:.:.  :|..||:..|::.:.
 Frog   387 ITACGPFTTSDTITYDALKDLIDVLNRDCPDICILLGPFLDAKHEQIENLQLTVTFEDVFKRCLK 451

  Fly   426 GIMESI---GSHTAVLVVTSQKDAMALSVYPTPP-----PALRRTYPNLYMLPDPSLVDLDGFTL 482
            .|:|..   |.|  ::.|.|.:|.....|||.||     || :.....::.:.||..:.::|..|
 Frog   452 MIIEGTRLSGCH--LVFVPSLRDVHHDPVYPQPPFSCFEPA-KEDKDRVHFVADPCTLSVNGVIL 513

  Fly   483 GVTSTDVVDHLLSHEF--AVNAGERMHRAINHLFHQGSFYPLYPPADEDMAYDSQLALKYAQLKQ 545
            |:||||::.|:.:.|.  :|.|.:|..|.:.|:..|.|:|||||| :|::..|.:....||.:..
 Frog   514 GITSTDLLFHMGAEEISSSVGAPDRFSRILRHILTQRSYYPLYPP-NEEINVDYEAFYSYAPMPV 577

  Fly   546 LPNVLILPSDQRHFIRLVNDCLVINPGRVA-DKKGGTFARFLVAPSVPGKAANMFNSVACQVQRI 609
            .|::.|:||:.|:||:.|..|:.|||||:. ...|||:|||||.....|........::.||.||
 Frog   578 TPDIFIVPSELRYFIKDVTGCICINPGRLTKGLVGGTYARFLVKSGAMGSEGKRSPCISAQVVRI 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNApol-alpha73NP_733206.3 Pol_alpha_B_N 18..>180 CDD:285602 43/168 (26%)
DNA_pol_E_B 363..561 CDD:281968 74/210 (35%)
pola2XP_012816322.1 POL12 65..630 CDD:227539 176/625 (28%)
Pol_alpha_B_N 66..291 CDD:285602 59/265 (22%)
DNA_pol_E_B 389..593 CDD:281968 74/208 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238492068
eggNOG 1 0.900 E1_COG5214
Hieranoid 1 1.000
Homologene 1 1.000 H48121
Inparanoid 1 1.050 216 1.000 Inparanoid score I3401
OMA 1 1.010
OrthoDB 1 1.010 D239034at33208
OrthoFinder 1 1.000 FOG0004201
OrthoInspector 1 1.000 T1059836
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R342
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.