DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNApol-alpha73 and spb70

Sequence 1:NP_733206.3 Gene:DNApol-alpha73 FlyBaseID:FBgn0005696 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_587765.1 Gene:spb70 PomBaseID:SPCC553.09c Length:574 Species:Schizosaccharomyces pombe

Alignment Length:561 Identity:137/562 (24%)
Similarity:232/562 (41%) Gaps:136/562 (24%)


  Fly   109 PMLDDYVSESAVDSSALHTPKAKKQSDR--TANLKGAALFSPASYTPQSAKRKAGLETPS---NS 168
            |.||       :|:........|.|.:|  .|.||            |:.:||:..:.|.   :|
pombe    43 PKLD-------LDTFKAFAKDMKFQMERQVKATLK------------QNPERKSIKQIPGMNIDS 88

  Fly   169 VAGKPGDIVDTFGHPKLLAGSSWQSQMEHTVPVTQ--KLLHNDAPLTIANLGYMNDLLTD----- 226
            :.|.|           :...:|..|.|:.:.|.|:  :|..:||...:..|.....::|.     
pombe    89 ILGLP-----------VKTTASGDSLMQESKPSTETFELNSSDAGRVLEVLNKELKIVTSKPSAP 142

  Fly   227 -----------RCHNLRVRFNQ--TGPALVDKKLGQAGAAECIWYPQDRQVLQSAGGLH-----A 273
                       :..|.|:.:.:  ....::|.::....|..|..|....:.|.:...|.     .
pombe   143 SKLVIVANFDLKAFNYRIMYQKLYDSSEVLDDRIELFSALTCRKYNISDEDLANPSELTQEPVVV 207

  Fly   274 VGMIHSED---DGPLDAHSAFMAVLDDDVEDEMDPTLTLNFSRVKSASIFPGQVVLAKGFIPRGK 335
            ||.|..|.   .|.|:.:|   .:|:..........:.|....:.|.||||||:|..||..|.|.
pombe   208 VGRIVVESTNLGGRLNQNS---ILLESSRRLGAGVRVRLKVDDLPSYSIFPGQIVSVKGSNPSGN 269

  Fly   336 TFMVEEIHTERKLTPATPLQI----------------DRELQFVVASGPFTDSTDLFYEPLHDLL 384
            .|:.:||      .|..||..                ::.:...:||||::...||.:.||..::
pombe   270 MFIAKEI------LPIPPLPFPSSSKQEHATFVANTNNQPISIYIASGPWSLRDDLSFSPLKSMI 328

  Fly   385 KYLKDHRPDVLVLTGPFLDADHKMV------GELAETFDTFFEKMIGGIMESIGSHTAVLVVTSQ 443
            .|:..:..|:::|.|||||.:|.::      |..|.:.:..|::.:..|:..:  ....:::...
pombe   329 SYVNKNPVDLVILCGPFLDINHILIRTGNITGTSATSLEELFKERVTPILSQL--TCPCILIPHI 391

  Fly   444 KDAMALSVYPT-PPPALRRTY----PNLYMLPDPSLVDLDGFTLGVTSTDVVDH--------LLS 495
            .|  |.|.:|. |..|..|..    .|....|:|.:..::....||::.|::.|        |.|
pombe   392 ND--AASDHPAWPQDAFNRVALGLPSNFKCFPNPCMFSINDVVFGVSTNDILLHTSREELFRLPS 454

  Fly   496 HEFAVNAGERMHRAINHLFHQGSFYPLYP--------PADEDMAYDSQLALKYAQ-LKQLPNVLI 551
            |      |....|.::|:.||..||||:|        |::.|:|:     ||..: |..:|::||
pombe   455 H------GNLFARLVSHVLHQRHFYPLFPGGSLEKCNPSNLDIAH-----LKLGEFLNTMPDILI 508

  Fly   552 LPSDQRHFIRLVNDCLVINPGRVADKKG---GTFARFLVAP 589
            ||||.|:|::.|.:.:.:|||:..  ||   ||||:..:||
pombe   509 LPSDLRYFVKNVENVVSLNPGKAT--KGINLGTFAKLTIAP 547

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNApol-alpha73NP_733206.3 Pol_alpha_B_N 18..>180 CDD:285602 17/76 (22%)
DNA_pol_E_B 363..561 CDD:281968 63/226 (28%)
spb70NP_587765.1 POL12 1..574 CDD:227539 137/562 (24%)
Pol_alpha_B_N 7..198 CDD:285602 34/185 (18%)
DNA_pol_E_B 307..518 CDD:281968 63/226 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004201
OrthoInspector 1 1.000 T1125088
orthoMCL 1 0.900 OOG5_128793
Panther 1 1.100 LDO PTHR23061
Phylome 1 0.910 0.958 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R342
TreeFam 1 0.960
87.900

Return to query results.
Submit another query.