DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNApol-alpha73 and POLA2

Sequence 1:NP_733206.3 Gene:DNApol-alpha73 FlyBaseID:FBgn0005696 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_002680.2 Gene:POLA2 HGNCID:30073 Length:598 Species:Homo sapiens

Alignment Length:630 Identity:188/631 (30%)
Similarity:301/631 (48%) Gaps:60/631 (10%)


  Fly     3 EELKQQFDEMGVEPADAVLGRCAELAITYNIHDATEFVEQWMAFSLS-HLQGEDPAIENLGDFER 66
            ::|.::....|::..:|::.:..||.:.|. .:....|.:.:||..| |..|....|  |..||.
Human     6 QQLAEELQIFGLDCEEALIEKLVELCVQYG-QNEEGMVGELIAFCTSTHKVGLTSEI--LNSFEH 67

  Fly    67 KVLQLRKDKAGYKATGQKAKSYGSPSVQDTSSLATYGVMEDDP--MLDDYVSES-AVDSSALHTP 128
            :.|..|..||.:..    .|..|....:|..|:.....:|::.  :|:.|.:.| .....|:.||
Human    68 EFLSKRLSKARHST----CKDSGHAGARDIVSIQELIEVEEEEEILLNSYTTPSKGSQKRAISTP 128

  Fly   129 KAKKQSDRTANLKGAALFSPASYTPQSAKRKAGLETPS---NSVAGKPGDIVDTFGHPKLLAGSS 190
            :........:......|.||:|::|.:        |||   ||.:.: |::|.:||   |..|.|
Human   129 ETPLTKRSVSTRSPHQLLSPSSFSPSA--------TPSQKYNSRSNR-GEVVTSFG---LAQGVS 181

  Fly   191 WQSQMEHTVPVTQKLLHNDAPLTIANLGYMNDLLTDRCHNLRVRFNQTGPALVDKKLGQAGAAEC 255
            | |.......::.|:|.....|| .:...|...|.|....|..:..:.|..|  |:..:..|...
Human   182 W-SGRGGAGNISLKVLGCPEALT-GSYKSMFQKLPDIREVLTCKIEELGSEL--KEHYKIEAFTP 242

  Fly   256 IWYPQDRQVLQSAGGLHAVGMIHSEDDGPLDAHSAFMAVLDDDVEDEMDPTLTLNFSRVKSASIF 320
            :..|....|.       .:|.|..:.:|.|:..|   .:|:.|.|......:.::.|.:|..|:|
Human   243 LLAPAQEPVT-------LLGQIGCDSNGKLNNKS---VILEGDREHSSGAQIPVDLSELKEYSLF 297

  Fly   321 PGQVVLAKGFIPRGKTFMVEEIHTERKLTPATPLQIDRELQ---FVVASGPFTDSTDLFYEPLHD 382
            |||||:.:|....|:..:..:::....|....|.:.|.:.:   .:||.||:|.|..:.|:||.|
Human   298 PGQVVIMEGINTTGRKLVATKLYEGVPLPFYQPTEEDADFEQSMVLVACGPYTTSDSITYDPLLD 362

  Fly   383 LLKYLKDHRPDVLVLTGPFLDADHKMVGE--LAETFDTFFEKMIGGIME---SIGSHTAVLVVTS 442
            |:..:...||||.:|.||||||.|:.|..  |...|:..|::.:..|:|   |.|||  ::.|.|
Human   363 LIAVINHDRPDVCILFGPFLDAKHEQVENCLLTSPFEDIFKQCLRTIIEGTRSSGSH--LVFVPS 425

  Fly   443 QKDAMALSVYPTPP----PALRRTYPNLYMLPDPSLVDLDGFTLGVTSTDVVDHLLSHEFAVNAG 503
            .:|.....|||.||    ...|.....:..:.:|..:.::|...|:||||::.||.:.|.:.::|
Human   426 LRDVHHEPVYPQPPFSYSDLSREDKKQVQFVSEPCSLSINGVIFGLTSTDLLFHLGAEEISSSSG 490

  Fly   504 --ERMHRAINHLFHQGSFYPLYPPADEDMAYDSQLALKYAQLKQLPNVLILPSDQRHFIRLVNDC 566
              :|..|.:.|:..|.|:|||||| .||||.|.:....||||...|:|||:||:.|:|::.|..|
Human   491 TSDRFSRILKHILTQRSYYPLYPP-QEDMAIDYESFYVYAQLPVTPDVLIIPSELRYFVKDVLGC 554

  Fly   567 LVINPGRVA-DKKGGTFAR-FLVAPSVPGKAANMFNSVACQVQRI 609
            :.:||||:. .:.|||||| :|..|:..| |......:|.||.||
Human   555 VCVNPGRLTKGQVGGTFARLYLRRPAADG-AERQSPCIAVQVVRI 598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNApol-alpha73NP_733206.3 Pol_alpha_B_N 18..>180 CDD:285602 41/169 (24%)
DNA_pol_E_B 363..561 CDD:281968 81/209 (39%)
POLA2NP_002680.2 Pol_alpha_B_N <115..238 CDD:331579 34/139 (24%)
Pol_alpha_B_N <206..583 CDD:331579 127/392 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238490182
eggNOG 1 0.900 E1_COG5214
Hieranoid 1 1.000
Homologene 1 1.000 H48121
Inparanoid 1 1.050 209 1.000 Inparanoid score I3634
Isobase 1 0.950 0 Normalized mean entropy S3706
OMA 1 1.010
OrthoDB 1 1.010 D239034at33208
OrthoFinder 1 1.000 FOG0004201
OrthoInspector 1 1.000 T1073772
orthoMCL 1 0.900 OOG5_128793
Panther 1 1.100 LDO PTHR23061
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R342
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.