DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNApol-alpha73 and Pola2

Sequence 1:NP_733206.3 Gene:DNApol-alpha73 FlyBaseID:FBgn0005696 Length:609 Species:Drosophila melanogaster
Sequence 2:XP_011246909.1 Gene:Pola2 MGIID:99690 Length:658 Species:Mus musculus

Alignment Length:705 Identity:191/706 (27%)
Similarity:301/706 (43%) Gaps:150/706 (21%)


  Fly     3 EELKQQFDEMGVEPADAVLGRCAELAITYNIHDATE--FVEQWMAFSLSHLQGED-PAIENLGDF 64
            ::|.::....|::..|::|.:.|||.:.|.   .||  .|.:.:||..|  .|:. ..::.|..|
Mouse     6 QQLAEELQIFGLDYEDSLLEKLAELCVLYR---QTEDGMVSELIAFCTS--AGKTCLTVDILNSF 65

  Fly    65 ERKVLQLRKDKAGYKATGQKAKSYGSPSVQD-----------------TSSLATYGVMEDDPMLD 112
            |.:||..:..||.:.|    :|..|....:|                 ||........|::.:|.
Mouse    66 EYEVLNKKLSKAWHSA----SKDSGHAGTRDIVSIQELYPFLLKLLSLTSVFRIEAEEEEETLLS 126

  Fly   113 DYVSESAVD----SSALHTPKAKKQSDRTANLKGAALFSPASYTPQSAKRKAGLETPSNSVAGKP 173
            .|.:.|...    ||...||..|:.   .|......|.||:|::|.:        |||.....:.
Mouse   127 SYTTPSKGPLKRVSSTPETPLTKRS---VAARSPRQLLSPSSFSPSA--------TPSQKYTSRT 180

  Fly   174 --GDIVDTFGHPKLLAGSSWQSQMEHTVPVTQKLLHNDAPLT------IANLGYMNDLLTDRCHN 230
              |::|.|||..:   |.|| |....:..|:.|::.:..|||      ...|..:.::||.:...
Mouse   181 NRGEVVTTFGSAQ---GLSW-SGRGGSGSVSLKVVGDPEPLTGSYKAMFQQLMGVREVLTSKIEE 241

  Fly   231 LRVRFNQTGPALVDKKLGQAGAAECIWYPQDRQVLQSAGGLHAVGMIHSEDDGPLDAHSAFMAVL 295
            |       |..|  |:..:..|...:..|....|:       .:|.|..:.:|.|::.|   .:|
Mouse   242 L-------GSEL--KEHHKIEAFTPLLVPAQEPVI-------LLGQIGCDSNGKLNSKS---VIL 287

  Fly   296 DDDVEDEMDPTLTLNFSRVKSASIFPGQVVLAKGFIPRGKTFMVEEIHTERKLTPATPLQI---- 356
            :.|.|......:.::.|.:|..|:||||||:.:||...|:..      |..||....||..    
Mouse   288 EGDQEHSYGAQIPVDLSELKEYSLFPGQVVIMEGFNTTGRRL------TATKLYEGVPLPFYQPT 346

  Fly   357 -----DRELQFVVASGPFTDSTDLFYEPLHDLLKYLKDHRPDVLVLTGPFLDADHKMVG--ELAE 414
                 ..:...|||.||:|.|..:.|:||.||:..:...:|||.:|.||||||.|:.|.  :|..
Mouse   347 EEEGASEQTMVVVACGPYTTSDSITYDPLLDLIAIINRDQPDVCILFGPFLDAKHEQVENCKLTS 411

  Fly   415 TFDTFFEKMIGGIME----------------------------------------------SIGS 433
            .|:..|::.:..::|                                              |.||
Mouse   412 PFEDVFKQCLRTVIEGTRRQQFSSVKGATKIKRRCVLSYVHQIQISMFMCQEVAFPSRGPASSGS 476

  Fly   434 HTAVLVVTSQKDAMALSVYPTPP----PALRRTYPNLYMLPDPSLVDLDGFTLGVTSTDVVDHLL 494
            |  ::.|.|.:|.....|||.||    ...|.....:..:.:|..:.::|...|:||||::.|:.
Mouse   477 H--LVFVPSLRDVHHEPVYPQPPFTFSELSREDKKRVQFVSEPCSLSINGVMFGLTSTDLLFHIG 539

  Fly   495 SHEFAVNAG--ERMHRAINHLFHQGSFYPLYPPADEDMAYDSQLALKYAQLKQLPNVLILPSDQR 557
            :.|...::|  :|..|.:.|:..|.|:|||||| .||||.|.:....||||...|:|.|:||:.|
Mouse   540 AEEIFSSSGTSDRFSRVLKHILTQRSYYPLYPP-HEDMAIDYENFYTYAQLPVTPDVFIVPSELR 603

  Fly   558 HFIRLVNDCLVINPGRVA-DKKGGTFARFLV--APSVPGKAANMFNSVACQVQRI 609
            :|::.:..|:.:||||:. .:.||||.|..:  .|...........|||.||.||
Mouse   604 YFVKDIFGCVCVNPGRLTKGQVGGTFGRLYLRRQPKAMDGGGRQGLSVAAQVVRI 658

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNApol-alpha73NP_733206.3 Pol_alpha_B_N 18..>180 CDD:285602 47/188 (25%)
DNA_pol_E_B 363..561 CDD:281968 78/252 (31%)
Pola2XP_011246909.1 Pol_alpha_B_N 20..253 CDD:285602 65/266 (24%)
DNA_pol_E_B 358..607 CDD:281968 78/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238490377
eggNOG 1 0.900 E1_COG5214
Hieranoid 1 1.000
Homologene 1 1.000 H48121
Inparanoid 1 1.050 210 1.000 Inparanoid score I3634
Isobase 1 0.950 0 Normalized mean entropy S3706
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004201
OrthoInspector 1 1.000 T1083848
orthoMCL 1 0.900 OOG5_128793
Panther 1 1.100 LDO PTHR23061
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R342
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.