DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNApol-alpha73 and div-1

Sequence 1:NP_733206.3 Gene:DNApol-alpha73 FlyBaseID:FBgn0005696 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_499268.1 Gene:div-1 WormBaseID:WBGene00001002 Length:581 Species:Caenorhabditis elegans

Alignment Length:596 Identity:131/597 (22%)
Similarity:238/597 (40%) Gaps:151/597 (25%)


  Fly   108 DPMLDDYVS------ESAVDSSAL---------------HTPKAKKQSDR--------------- 136
            :.::||.||      :.:|||..|               |||::.|:..|               
 Worm    43 EDIVDDVVSVMSNLGQKSVDSGILAKLEENLEAQAQKTVHTPRSVKKPARGRVPLAEKSGFILSG 107

  Fly   137 ----------------TANLKGAAL-FSPASYTPQSAK--RKAGLETPSNSVAGKPGDIVDTFGH 182
                            .|.|:|..| |||...:|.:.|  ::|           .|..:|.|...
 Worm   108 DPDDIEKPSHHLTNSAIAKLEGHFLDFSPFPGSPANEKFLKRA-----------DPSHVVTTIRG 161

  Fly   183 PKL----LAGSSWQSQMEHTVPVTQKLLHNDAPLTIANLGYMND-----------LLTDRCHNLR 232
            .|.    |.||   ::.:.|:.:..|     .|.|:    |..|           .:.|..|.::
 Worm   162 KKYQDKGLKGS---TKSDDTIRIISK-----TPSTL----YGGDKSSMVIEAKAQRMADIAHRIQ 214

  Fly   233 VRFNQTGPALVDKKLGQAGAAECIWYPQDRQVLQSAGGLHAVG-MIHSE--DDGPLDAHSAFMAV 294
            ..|.:    :||            |   ....:.|...::..| :||.|  |:.....||..:.:
 Worm   215 KSFEE----IVD------------W---GNPSIPSVDVVYTYGQVIHDETKDNEKFGEHSVALMI 260

  Fly   295 LDDDVEDEMDPTLTLNFSRV-KSASIFPGQVVLAKGFIPRGKTFMVEEIHTERKLTPATPLQIDR 358
            .|:|     ...:.::||:: :..::||||::..:|....|:...|::|.....| |..|::.|.
 Worm   261 NDED-----GTMIRMDFSKMTEDITLFPGQIIAVRGTNETGEELQVDKIFQPAAL-PVNPVETDT 319

  Fly   359 ELQFVVASGPFTDSTDLFYEPLHDLLKYLKDHRPDVLVLTGPFLDADHKMVGE--LAETFDTFFE 421
            ..:...|.||:|.:.:..||.|.:||..:...:||:|:|.|||:|..:..:.:  ...|:|...|
 Worm   320 TKEIWFACGPYTATDNCGYEHLCELLDKVVAEKPDILMLAGPFVDKKNTFLNKPTFNITYDNLLE 384

  Fly   422 KMIGGIMES-IGSHTAVLV-VTSQKDAMALSVYPTPP----PALRRTYPNLYMLPDPSLVDLDGF 480
            .::..:.|: :|:.|.|:: ..:.:|.....|:|:.|    ..|.:....|..:.||.:..:.|.
 Worm   385 DLLLKVKETLVGTKTQVIIQPNASRDLCVPPVFPSAPFQQNRKLDKIKKELIFVADPCIFRISGV 449

  Fly   481 TLGVTSTDVVDHLLSHEFAVNAG----ERMHRAINHLFHQGSFYPLYP---PAD-EDMAYDSQLA 537
            .:.:||::.:..|.:.||..:|.    :|:.|..:||..|...|||.|   ||. .|:       
 Worm   450 EVAMTSSEPIQALSNTEFHRSANQENIDRVARLSSHLLTQQCMYPLEPTEVPASMGDL------- 507

  Fly   538 LKYAQLKQLPNVLILPSDQRHFIRLVNDCLVINPGRVADKKGGTFARFLV----APSVPGKAANM 598
            |....:...|:::..|:......:.||..:.||...:|....|.:|:..:    ...:||:....
 Worm   508 LDVCCIGSTPHIVFAPTKLAPSAKCVNGSVFINSSTLAKGPTGNYAKMSINLNAGELMPGETVAD 572

  Fly   599 FNSVACQVQRI 609
            :..:  |:.:|
 Worm   573 YAQI--QILKI 581

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNApol-alpha73NP_733206.3 Pol_alpha_B_N 18..>180 CDD:285602 26/127 (20%)
DNA_pol_E_B 363..561 CDD:281968 54/214 (25%)
div-1NP_499268.1 DNA_pol_E_B 324..531 CDD:281968 54/214 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238487453
eggNOG 1 0.900 E1_COG5214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I3495
Isobase 1 0.950 0 Normalized mean entropy S3706
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D239034at33208
OrthoFinder 1 1.000 FOG0004201
OrthoInspector 1 1.000 T477068
orthoMCL 1 0.900 OOG5_128793
Panther 1 1.100 LDO PTHR23061
Phylome 1 0.910 0.966 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R342
TreeFam 1 0.960
1211.740

Return to query results.
Submit another query.