DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5909 and try-3

Sequence 1:NP_651544.1 Gene:CG5909 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_500999.3 Gene:try-3 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans

Alignment Length:284 Identity:67/285 (24%)
Similarity:122/285 (43%) Gaps:50/285 (18%)


  Fly   117 NSVTNCGNKGNP----KVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCI- 176
            |::..|.....|    ::.||.:...| ..|:|.|....::.:...||.::|.:..::|||||. 
 Worm    21 NAINLCEESYKPIFSFRIIGGNSIDDG-ANWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCAL 84

  Fly   177 -IDQPEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKL 240
             :.....:.||..:::.|                   ..:.:::..:|..|.:....:|:|::::
 Worm    85 QLQTRSFVYVREPKNNRE-------------------RSFSVKEAYIHSGYNNQTADNDIALLRI 130

  Fly   241 DRVVKEKSHIKPVCLPIDQKSQELDFDQSFFVAGWG--------GTEKETVATKLQQALITRKSL 297
            ...: .|..|||||| :...|:.|...::..|.|:|        |..|...:..||...:...|.
 Worm   131 SSDL-SKLGIKPVCL-VHDDSKLLKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISD 193

  Fly   298 NECRQYYN-----KGEVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFG--- 354
            ::|.:.:.     ..:::...||| |..:..|..||||||:.. |:....|  ||.|:.|:|   
 Worm   194 DDCVKTWRFLSLLSVKITGYQICA-GAYLHGTAPGDSGGPLLI-HKSNGEY--VQIGITSYGADG 254

  Fly   355 --GRLCGQNQPGVFASVIDMLPWI 376
              |.:.....|||:..:...:|||
 Worm   255 LDGVIDQGKFPGVYTRISKYVPWI 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 63/267 (24%)
Tryp_SPc 132..379 CDD:238113 64/266 (24%)
try-3NP_500999.3 Tryp_SPc 37..278 CDD:214473 63/267 (24%)
Tryp_SPc 38..279 CDD:238113 64/268 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124149922
eggNOG 1 0.900 E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.